Dataset for protein Bad of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7KHU4_BAD-01      --------------------------------------------------
A0A8C7KKS5_BAD-01      --------------------------------------------------
A0A8C7DT45_BAD-01      --------------------------------------------------
A0A8C7DT45_BAD-02      --------------------------------------------------
A0A8C7DT45_BAD-03      MPRLSWPPELKLGTKIQGLFRVKHMCNNVVFLSSLPLFSFSPLSALSPSL
                                                                         

A0A8C7KHU4_BAD-01      --------------------------------------------------
A0A8C7KKS5_BAD-01      --------------------------------------------------
A0A8C7DT45_BAD-01      --------------------------------------------------
A0A8C7DT45_BAD-02      --------------------------------------------------
A0A8C7DT45_BAD-03      FLSLCPLSLPSLSALSRSPLSLSIPLPLSLPSLSPSLFLSLCPLSLSPSL
                                                                         

A0A8C7KHU4_BAD-01      --------------------------------------------------
A0A8C7KKS5_BAD-01      --------------------------------------------------
A0A8C7DT45_BAD-01      --------------------------------------------------
A0A8C7DT45_BAD-02      --------------------------------------------------
A0A8C7DT45_BAD-03      FLSLCPLSLSPSLFLSLCPLSLSPSLFPSLSALSLSLHPSSPLSLHPSSP
                                                                         

A0A8C7KHU4_BAD-01      ------------------------------------------------MD
A0A8C7KKS5_BAD-01      --------------------------------------------------
A0A8C7DT45_BAD-01      ----------------------------------------------MAQM
A0A8C7DT45_BAD-02      ----------------------------------------------MAQM
A0A8C7DT45_BAD-03      LSLPSLLSLCPLSSLSALSPSLSIPLPLSLSIPLPLLTHSSSIDVSMAQM
                                                                         

A0A8C7KHU4_BAD-01      HIHDCVDECESDHSGTTHNSEFQL----------HVSTTMSNRPRPGERV
A0A8C7KKS5_BAD-01      ----MNEQDESDHSGTTHYPEFQ---------LHNVSATTSIRPRPGGRA
A0A8C7DT45_BAD-01      FTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRL
A0A8C7DT45_BAD-02      FTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRL
A0A8C7DT45_BAD-03      FTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRL
                             :.  *:  * *   : .           :. :. . *     * 

A0A8C7KHU4_BAD-01      RLYSESQVCSQVGKREDTEFLDVMTPTEDGGGDGASFRGRSQSAPPALWA
A0A8C7KKS5_BAD-01      RLYSESQVCSQVGRRDDTEFQDAITPTEEGGGDGAPFRSRSQSAPPTLWA
A0A8C7DT45_BAD-01      RMNSESQAQELQGRGPGVEGMPT---------DGASFRGRSQSAPPALWA
A0A8C7DT45_BAD-02      RMNSESQAQELQGRGPGVEGMPT---------DGASFRGRSQSAPPALWA
A0A8C7DT45_BAD-03      RMNSESQAQELQGRGPGVEGMPT---------DGASFRGRSQSAPPALWA
                       *: ****. .  *.  ..*   .         ***.**.*******:***

A0A8C7KHU4_BAD-01      AKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKV-SRGWFSFLWSPK
A0A8C7KKS5_BAD-01      AKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEV-SRGWFSFLWSPN
A0A8C7DT45_BAD-01      AKRYGRQLRRMSDEFDTWLDKGRC------------------YCKVFRCS
A0A8C7DT45_BAD-02      AKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHK
A0A8C7DT45_BAD-03      AKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHK
                       **.** ****************                    :. ::  .

A0A8C7KHU4_BAD-01      EAEGRE--------------------------------------------
A0A8C7KKS5_BAD-01      EAEGRE--------------------------------------------
A0A8C7DT45_BAD-01      PNQ--------------------------PPTLPGGPNSFPIPSMLGAG-
A0A8C7DT45_BAD-02      ETERWRRERIGRRGGWAYLFSHQETTHRNRTTIEPRSSEYREGDVSHANK
A0A8C7DT45_BAD-03      ETE-----------------------TEHTPIIPPRSSE-----------
                         :                                               

A0A8C7KHU4_BAD-01      --
A0A8C7KKS5_BAD-01      --
A0A8C7DT45_BAD-01      --
A0A8C7DT45_BAD-02      AP
A0A8C7DT45_BAD-03      --
                         

© 1998-2022Legal notice