Dataset for protein classical BH3-containing proteins of organism Neovison vison

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :*.:  .* : :   :** :  *  .**:  * :   *                                       
makqPsdvssEcdreggqlQPverpPqlrPGaptSlqteqQ--------r-----------p---p--------------
--me pqcve ledd--vf  edge gtq  sll adlfa gnpegegd-cpqgspqgpla-pas-gpfatrsplfifvr
                                         sqldcpls lhlfplthccg glr tsqedka       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               *. *   . :.**.:             *.*:.
-----------------drspapmscdkstqtpsppcqafnhylsamAsrR--qsqavPAdm-------------RpEmw
rssllsrsssgyfsfdt------------------------------ gy lplpasf  glplgdqppegqwqh a vq
                 tqtls a psqgvml cgvteepqrlfygn                                 
                                                                                

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
**.:*. *.*:*:  : ..                                         
IAqeLrrIgDeFnayyprrleq--------------------------------------
  rk qc a q hrlhmqqvqrnpyscleanqqrvwwrllrylirlvwrlqgnrngagpr
                   hflinapaac hpnmiilqi lfihn alnad         
                    a                                       
© 1998-2020Legal notice