Dataset for protein classical BH3-containing proteins of organism Neovison vison

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :*.:  .* : :   :** :  *  .**:  *   :  .*                                     
makqPsdvssEcdreggqlQPverpPqlrPGaptS---lqteQq--p-------p-----gp---p-s----at------
--me pqcve ledd--vf  edge gtq  sll adlfaqs lgn-egegdrc-qgspq--lap-a-pgpf--rtlspa
                                            dc lsrlhlf lthcc  glr t qedk  q     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     *.*:.**.:*.
sp-----------------------drspapmscdkstqt-psppcqafnhylsamasrrqsqavpadmRpEmwIAqeLr
--lfifvrrssllsrsssgyfsfdt---------------g---------------------------- a vq  rk q
  sqgvmlpcgvteepqrlfygnagy l l a fpaglpl dq  egqwq                              
                                                                                

       170       180       190       200       210    
....:....|....:....|....:....|....:....|....:....|....
 *.*:*:  : ..                                         
rIgDeFnayyprrleq--------------------------------------
c a q hrlhmqqvqrnpyscleanqqrvwwrllrylirlvwrlqgnrngagpr
             hflinapaac hpnmiilqi lfihn alnad         
              a                                       
© 1998-2022Legal notice