Dataset for protein classical BH3-containing proteins of organism Neovison vison

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
makqpsdvssecdreggqlqpverppqlrpgaptslqteqq---------------------------------------
------------exxxxxxrxxxxxxxxxxpxxlxxxl---gnpegegdrcpqgspqgplappaspgpfatrsplfifvr
 fqimexxxxxx-msspvfxksgqssttqqxslxgmh-xxxxxlxxxxxxxxxxpxxxxxxxgxxxxxxxxxxxxxxxxx
      ppqcvqxlpdkkd gldpe pgda pgpekexqtasqxlcplshqqlqxltsshhgxlravstrsk        
      fep  e d  daa  eag  ga    d  ad fa pg d  ag lhgf ashccg   g teqed         
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         . :*. :
-----------------drspapmscdkstqtpsppcqa----l-amasrrqsqavpadmrpemw-------iaqeLrri
rssllsrsssgyfsfdt-------------e--------fnhy-s-----p--------------qrraevrygrq qkm
xxxxxxxxxxxxxxxxsypqgvmspegvte-sqvlfygrsryrppnlcgg-tqlppgvrppegq ah    qc ik  cf
        atqtl psxxsa tlldaephl plr srpnagsa  lp aflaga l dqge          e  a     
              ha p   see   me  e    a g          a                              
                                                                                
                                                                                

       170       180       190       200       210    
....:....|....:....|....:....|....:....|....:....|....
.*.::  .                                              
gDefnayyprrl------------------------------------------
a qlq-lf----lqnsaqtaqqrtqsvwwrvlyylirlwwrlqrgrggsgpsqn
s k hr-hrqlverlpysqltsnrrrssltl rrvhqsvlprpln napemrp 
  d  gs kgkpfpknsplhramqnppp qi lni ngl nang    aa e  
        e   aniirkefe hp mii     f  m a d d           
             l  mgcec gh                              
                  a                                   
© 1998-2022Legal notice