Dataset for protein classical BH3-containing proteins of organism Neovison vison

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U6CTE3_BCL2L11-03      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTS---LQTEQQ------
U6CTE3_BCL2L11-04      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTS---LQTEQQ------
U6CSY8_BMF-01          --MEPPQCVEELEDD--VFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
U6CTE3_BCL2L11-01      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTS---LQTEQQGNPEGE
U6CTE3_BCL2L11-02      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTS---LQTEQQGNPEGE
                          :*.:  .* : :   :** :  *  .**:  *   :  .*       

U6CTE3_BCL2L11-03      --------------------------------------------------
U6CTE3_BCL2L11-04      --------------------------------------------------
U6CSY8_BMF-01          LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLF
U6CTE3_BCL2L11-01      GDRCPQGSPQGPLAPPASPGPFATR-----SPLFIFVRRSSLLSRSSSGY
U6CTE3_BCL2L11-02      GDRCPQGSPQGPLAPPASPGPFATR-----SPLFIFVRRSSLLSRSSSGY
                                                                         

U6CTE3_BCL2L11-03      -----DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQSQAVPADMR
U6CTE3_BCL2L11-04      ------------------------------------ASRRQSQAVPADMR
U6CSY8_BMF-01          YGNAGYRLPLPASFPAGLPLGDQPPEGQWQH------------------R
U6CTE3_BCL2L11-01      FSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQSQAVPADMR
U6CTE3_BCL2L11-02      FSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQSQAVPADMR
                                                                        *

U6CTE3_BCL2L11-03      PEMWIAQELRRIGDEFNAYYPRRLEQ------------------------
U6CTE3_BCL2L11-04      PEMWIAQELRRIGDEFNAYYPRRLARIPASCLC-----------------
U6CSY8_BMF-01          AEVQIARKLQCIADQFHRLHMQQHQQ--------NQNRVWWQILLFLHNL
U6CTE3_BCL2L11-01      PEMWIAQELRRIGDEFNAYYPRRVFLNNYPAAEAHPQMIILRLLRYIIRL
U6CTE3_BCL2L11-02      PEMWIAQELRRIGDEFNAYYPRRLEQ------------------------
                       .*:.**.:*. *.*:*:  : ..                           

U6CTE3_BCL2L11-03      --------------
U6CTE3_BCL2L11-04      --------------
U6CSY8_BMF-01          ALNADGNRNGAGPR
U6CTE3_BCL2L11-01      VWRLQ---------
U6CTE3_BCL2L11-02      --------------
                                     

© 1998-2022Legal notice