Dataset for protein classical BH3-containing proteins of organism Neovison vison

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7BEU9_PMAIP1-      -------------MPGKKARKSAQPSPARAPADPEME-------------
A0A8C7BAK5_BCL2L11      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A8C7BYN9_BAD-01       MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGLGKHLQTAPGLLGEAGH
U6CSY8_BMF-01           ----MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
A0A8C7AZM9_BBC3-01      ------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C7BAK5_BCL2L11      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A8C7BAK5_BCL2L11      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQ---------
A0A8C7BAK5_BCL2L11      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQ---------
                                                                          

A0A8C7BEU9_PMAIP1-      --------------------------------------------------
A0A8C7BAK5_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C7BYN9_BAD-01       QQGQPASSSHHGGAGAVETRSR----------------------HSSYPA
U6CSY8_BMF-01           LHLFPLTHCCGPGLRPTSQEDK----------------ATQTLSPASPSQ
A0A8C7AZM9_BBC3-01      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQ
A0A8C7BAK5_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C7BAK5_BCL2L11      --------------------------------------------------
A0A8C7BAK5_BCL2L11      -----------------------------------------------DRS
                                                                          

A0A8C7BEU9_PMAIP1-      --------------------------------------------------
A0A8C7BAK5_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMW-----
A0A8C7BYN9_BAD-01       GTEEDEGMEEEELSPFRGRSRSAPPNLCAAL-------------------
U6CSY8_BMF-01           GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPEGQWQHRAE
A0A8C7AZM9_BBC3-01      PSLSPAEPHLESPVPSAPG------ALAGGPTQAAPGVRGEEEQWAR---
A0A8C7BAK5_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMW-----
A0A8C7BAK5_BCL2L11      ---------------------------ASRRQSQAVPADMRPEMW-----
A0A8C7BAK5_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMW-----
                                                                          

A0A8C7BEU9_PMAIP1-      --CAIQLRKFGDKLN--FRQKLLNLISKLFRSGT----------------
A0A8C7BAK5_BCL2L11      --IAQELRRIGDEFNAYYPRRLEQ--------------------------
A0A8C7BYN9_BAD-01       -RYGRELRRMSDEFQGSFKGLPLPKSAGTATQMRQSPSWT---RVIQSWW
U6CSY8_BMF-01           VQIARKLQCIADQFHRLH--------MQQHQQNQNRVWWQILLFLHNLAL
A0A8C7AZM9_BBC3-01      -EIGAQLRRMADDLNALYERR-----RQEEQQRHRPSPWRVLYNLIMGLL
A0A8C7BAK5_BCL2L11      --IAQELRRIGDEFNAYYPRRVFLNNYPAAEAHPQMIILRLLRYIIRLVW
A0A8C7BAK5_BCL2L11      --IAQELRRIGDEFNAYYPRRLARIPASCLC-------------------
A0A8C7BAK5_BCL2L11      --IAQELRRIGDEFNAYYPRRLEQ--------------------------
                           . :*. :.*.::  .                                

A0A8C7BEU9_PMAIP1-      --------------
A0A8C7BAK5_BCL2L11      --------------
A0A8C7BYN9_BAD-01       DRNLGRGGSAPSQ-
U6CSY8_BMF-01           NADGNRNGAGPR--
A0A8C7AZM9_BBC3-01      PLPRGRGAPEMEPN
A0A8C7BAK5_BCL2L11      RLQ-----------
A0A8C7BAK5_BCL2L11      --------------
A0A8C7BAK5_BCL2L11      --------------
                                      

© 1998-2022Legal notice