Dataset for protein classical BH3-containing proteins of organism Neovison vison

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|U6CSY8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Neovison vison GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADGNRNGAGPR
>gnl|bcl2dbpro|U6CTE3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Neovison vison GN=BCL2L11 (length=111 residues).
MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAV
PADMRPEMWIAQELRRIGDEFNAYYPRRLEQ
>gnl|bcl2dbpro|U6CTE3_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Neovison vison GN=BCL2L11 (length=88 residues).
MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQASRRQSQAVPADMRPEMWIAQELRRIGDEFNAYYPRRLA
RIPASCLC
>gnl|bcl2dbpro|U6CTE3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Neovison vison GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|U6CTE3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Neovison vison GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMWIAQELRRIGDEFNAY
YPRRVFLNNYPAAEAHPQMIILRLLRYIIRLVWRLQ
© 1998-2020Legal notice