Dataset for protein Bad of organism Neogobius melanostomus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             .:.**:           :::.*.   :********
----------------------------------------lpyigrirLSs-----------esqvCg---eARAEEELG
maasftisdsesdpsedldeeqgnrakaqrklqmplvqprgnsshnvk  tcvqydpsdsdnktnt slglq        
                                 lkapelp ag                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************************************      *******************************
TPTDGFPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSMLDKG------NSRPIQHSKTWWSYLFSHQETEGENHHDSQR
                                           emkkmk                               
                                                                                

  
..
**
TE
  
  
© 1998-2022Legal notice