Dataset for protein Bad of organism Neogobius melanostomus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C6U7V6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Neogobius melanostomus GN=BAD (length=148 residues).
MAASFTISDSESDPSEDLDEEQGNRAKAQRKLQLKLPELRGAGIGRIRLSSESQVCGEARAEEELGTPTDGFPFRGRSKS
APPALWAAKKYGRQLRRMSDEFDSMLDKGEMKKMKNSRPIQHSKTWWSYLFSHQETEGENHHDSQRTE
>gnl|bcl2dbpro|A0A8C6U7V6_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Neogobius melanostomus GN=BAD (length=102 residues).
LNSIGRIRLSSESQVCGEARAEEELGTPTDGFPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSMLDKGNSRPIQHSKTW
WSYLFSHQETEGENHHDSQRTE
>gnl|bcl2dbpro|A0A8C6U7V6_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Neogobius melanostomus GN=BAD (length=123 residues).
MPAVQPPLPYSHNVKLSTCVQYDPSDSDNKTNTCSLGLQARAEEELGTPTDGFPFRGRSKSAPPALWAAKKYGRQLRRMS
DEFDSMLDKGNSRPIQHSKTWWSYLFSHQETEGENHHDSQRTE
© 1998-2022Legal notice