Dataset for protein Bad of organism Neogobius melanostomus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6U7V6_BAD-03      ---------------------------------MPAVQPPLPYSHNVKLS
A0A8C6U7V6_BAD-01      MAASFTISDSESDPSEDLDEEQGNRAKAQRKLQLKLPELRGAGIGRIRLS
A0A8C6U7V6_BAD-02      ----------------------------------------LNSIGRIRLS
                                                                    .:.**

A0A8C6U7V6_BAD-03      TCVQYDPSDSDNKTNTCSLGLQARAEEELGTPTDGFPFRGRSKSAPPALW
A0A8C6U7V6_BAD-01      S-----------ESQVCG---EARAEEELGTPTDGFPFRGRSKSAPPALW
A0A8C6U7V6_BAD-02      S-----------ESQVCG---EARAEEELGTPTDGFPFRGRSKSAPPALW
                       :           :::.*.   :****************************

A0A8C6U7V6_BAD-03      AAKKYGRQLRRMSDEFDSMLDKG------NSRPIQHSKTWWSYLFSHQET
A0A8C6U7V6_BAD-01      AAKKYGRQLRRMSDEFDSMLDKGEMKKMKNSRPIQHSKTWWSYLFSHQET
A0A8C6U7V6_BAD-02      AAKKYGRQLRRMSDEFDSMLDKG------NSRPIQHSKTWWSYLFSHQET
                       ***********************      *********************

A0A8C6U7V6_BAD-03      EGENHHDSQRTE
A0A8C6U7V6_BAD-01      EGENHHDSQRTE
A0A8C6U7V6_BAD-02      EGENHHDSQRTE
                       ************

© 1998-2022Legal notice