Dataset for protein classical BH3-containing proteins of organism Nannospalax galili

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------ma----d-sse---eg-----------gqlqpaerpeql
mpragvfwkqyralsrgllprqlvpaaaaaapcatrlpphp--kqps-v---cdr--vrrsetspssp-eme-pqcva--
                                         rltvtrpslappwvrdsemetsrwrpl ---g-----e 
                                          grprqepg  ephh lakdgp imhr sfmetrvwcg 
                                           lakl g   aha    a  h  if  rdi slls   
                                                                 fa  l a ga q   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .                                                                      
-------rpgapts---p---------lqteqql----l--------p--------------------------------
eddvfqpedaeqgtqsg-llspdlflqselacp-srlq-gplthggg-glrpisqedpgpkatrsplfifvrrssllsrs
llppv cm  seamptasvneasayeccssdnrvvtpgefgrswccaarstlvgprskakf rk a              
       a  l srfqi sglvreqaeapgse srpivdklprtprs qpparpaapd                      
             a ae efata m d  c a gngea adnqshlc dig ll  m                       
                  a     e        al a    dcp    ag  a                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            *. :
---------drspspascdkstqtpsppcqafnrylsamag-r---------------q--e-----r-e--iareLrri
ssgyfsfdttqtlaqmgpsqgvmlrcavteepqhlfygn--y-lplptsfpaglplge-sq-epaqi-a-vw---q qcm
         qtrhqcrrqtndshvggg------g-----psvt ederieeels frgrapsgqwdhypqiqygqk ksl
         ap    ielpmelthe  hlttrs-ptqyslaid               ger awprlwratr rgv  n 
          l      dhl  ea   geaqlp ismhp  t                  e    ne   qg  a     
                 aea        a lag ha  a                                         
                                                                                

       250       260       270       280       290    
....:....|....:....|....:....|....:....|....:....|....
                     .                                
gdefn---------r--lqqyqqnrdspwwqif-lfl--l-l-r--h-----p-
a-qlhasypslwsr-vhmnntwake-raqrvvlq-l-hn-r-v-rr-rdgag-r
th---sqgegiprwklf---qrvd-sh--m-l-ns-rfivawnwelnkpesl s
s s qglfk    p slttvlhrsqp-sf-r-yp wtlv p pgngrag me q
n k c          ragpsi mrplqlctk    vmgl l g dpg   la n
  d            f  eef  hl n  sa    i      d a         
                  ca                                  
© 1998-2022Legal notice