Dataset for protein classical BH3-containing proteins of organism Nannospalax galili

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A8C6Q939_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Nannospalax galili GN=BIK (length=150 residues).
MSETRPMARGLFIETLLQEQLLLPPVAPGAPGMTEPVGEVDLMECLEGSNQVALRLACIGDEMDLHLRSPHLTQLPGIAM
HSLAVTYRQTGIRGVLRSLTHSLCSLGESIWSWRFLTPVIWVSPDQACRQLLPLVLLVLLLGGALHLLPQ
>gnl|bcl2dbpro|A0A8C6Q9N0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Nannospalax galili GN=BAD (length=202 residues).
MGTPKRPSLAPAHARGVRKSESSIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDCSSAERSLGPVLAGDQSGLCPAPG
LLGDTSHQQRGATNSSHHGGAGAETRSRHSSYPAGTDEDERIEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFQGS
FKGLPRPKSAGTATQMRQSSSWTRIFQSWWDRNLGKGGSAPS
>gnl|bcl2dbpro|A0A8C6QGZ2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Nannospalax galili GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAQPAVTAALGGPRWPGA
PRSRPRGPRPDGPQPSLSPAEQHLESTVPSAPEALAGGPTQAAPGVRGEEEEWAREIGAQLRRMADDLNAQYERRRLEEQ
HRHRPSPWRAIYNLFMGLLPLPRDPRAPEMEPN
>gnl|bcl2dbpro|A0A8C6QXX9_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L11 (length=84 residues).
MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMELKNLNLCS
LQAK
>gnl|bcl2dbpro|A0A8C6QXX9_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PADIRPEIWIAQELRRIGDEFNASYPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|A0A8C6QXX9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQELRRIGDEFNAS
YPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|A0A8C6R2L6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Nannospalax galili GN=BMF (length=254 residues).
MPRAGVFWKQYRALSRGLLPRQLVPAAAAAAPCATRLPPHPRLLVTLDPGAEPWHHDSEAETHSWSHPGEMEPPQCVEEL
EDDVFQPEDGEPGTQSGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTE
EPQRLFYGNAGYRLPLPTSFPAGLPLGEQAPEGQWQHRAEVQIARKLQCIADQFHRLHMQQYQQNRDRAWWQVFLFLHNL
ALNREGNRDGAGPR
>gnl|bcl2dbpro|A0A8C6R2L6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Nannospalax galili GN=BMF (length=189 residues).
IFPGEMEPPQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPTSFPAGLPLGEQAPEGQWQHRAEVQIARKLQCIADQFHRLHMQQYQQN
RDRAWWQVFLFLHNLALNREGNRDGAGPR
>gnl|bcl2dbpro|A0A8C6RUL4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Nannospalax galili GN=PMAIP1 (length=104 residues).
MPGSEARQSAPSNATRAELELECAAQLRRIGDKLNSTGRAADITAVLAEMPGKKARKSAQRSPSPARLPADLEAECAQLR
RIGDKLNFRQKLLNLFSKLFNLIT
© 1998-2022Legal notice