Dataset for protein classical BH3-containing proteins of organism Nannospalax galili

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6R2L6_BMF-01       MPRAGVFWKQYRALSRGLLPRQLVPAAAAAAPCATRLPPHPRLLVTLDPG
A0A8C6Q939_BIK-01       --------------------------------------------------
A0A8C6RUL4_PMAIP1-      --------------------------------------------------
A0A8C6Q9N0_BAD-01       -----------------------------------------MGTPKRPSL
A0A8C6R2L6_BMF-02       --------------------------------------------------
A0A8C6QGZ2_BBC3-01      -----------------------------------------MARARQEGS
A0A8C6QXX9_BCL2L11      -----------------------------------------MAKQPSDVS
A0A8C6QXX9_BCL2L11      -----------------------------------------MAKQPSDVS
A0A8C6QXX9_BCL2L11      -----------------------------------------MAKQPSDVS
                                                                          

A0A8C6R2L6_BMF-01       AEPWHHDSEAETHSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQSGSLL
A0A8C6Q939_BIK-01       ---------MSETRPMARGLFIETLLQEQLLLPPV--APGAPGM-TEPVG
A0A8C6RUL4_PMAIP1-      -------------------------------------MPGSEARQSAPSN
A0A8C6Q9N0_BAD-01       APAHARGVRKSESSIRSLGSDAGGRRW----------RPAAQSMFQIPEF
A0A8C6R2L6_BMF-02       ---------------IFPGEMEPPQCVEELEDDVFQPEDGEPGTQSGSLL
A0A8C6QGZ2_BBC3-01      SPEPVEGLARDGPRPFPLGRLMPSAVSCGL------CEPGLPAAPAAPAL
A0A8C6QXX9_BCL2L11      SECDREG-----------GQLQPAERPAQL-------RPGAPTS------
A0A8C6QXX9_BCL2L11      SECDREG-----------GQLQPAERPAQL-------RPGAPTS------
A0A8C6QXX9_BCL2L11      SECDREG-----------GQLQPAERPAQL-------RPGAPTS------
                                                               .          

A0A8C6R2L6_BMF-01       SADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKA-----------
A0A8C6Q939_BIK-01       EVDLMECLEGSNQV------------------------------------
A0A8C6RUL4_PMAIP1-      ATRAELELECAAQLRRIGDKLNSTGRAADITAVLAEMPGKKARKSA----
A0A8C6Q9N0_BAD-01       EPSEQEDCSSAERSLGPVLAGDQSGLCPAPGLLG----------------
A0A8C6R2L6_BMF-02       SADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKA-----------
A0A8C6QGZ2_BBC3-01      LPAAYLCAPTAQPAVTAALGGPRWPGAPRSRPRGPRPDGP----------
A0A8C6QXX9_BCL2L11      -------LQTEQQ-------------------------------------
A0A8C6QXX9_BCL2L11      -------LQTEQQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIF
A0A8C6QXX9_BCL2L11      -------LQTEQQ-------------------------------------
                                                                          

A0A8C6R2L6_BMF-01       -------------------TQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A8C6Q939_BIK-01       -------------------ALRLACIGDEMDLHLRSPHLTQLPGIAMHSL
A0A8C6RUL4_PMAIP1-      -------------------QRSPSPARLPADLEAECA-------------
A0A8C6Q9N0_BAD-01       -------------------DTSHQQRGATNSSHHGGAGAETRSRHSSYPA
A0A8C6R2L6_BMF-02       -------------------TQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A8C6QGZ2_BBC3-01      -------------------QPSLSPAEQHLESTVPSAPEALAGGPTQAAP
A0A8C6QXX9_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-
A0A8C6QXX9_BCL2L11      VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A8C6QXX9_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
                                                                          

A0A8C6R2L6_BMF-01       GYRLPLPTSFPAGLPLGEQAPEGQWQHRAEVQIARKLQCIADQF------
A0A8C6Q939_BIK-01       AVT------------------------YRQTGIRGVLRSLTHSLCSLGES
A0A8C6RUL4_PMAIP1-      -----------------------------------QLRRIGDKL----N-
A0A8C6Q9N0_BAD-01       GTD-EDERIEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEF----QG
A0A8C6R2L6_BMF-02       GYRLPLPTSFPAGLPLGEQAPEGQWQHRAEVQIARKLQCIADQF----H-
A0A8C6QGZ2_BBC3-01      GVR---------------GEEEEWARE-----IGAQLRRMADDL----NA
A0A8C6QXX9_BCL2L11      -----------------------------------ELKNLN---------
A0A8C6QXX9_BCL2L11      SIR---------------QSQEEPADIRPEIWIAQELRRIGDEF----NA
A0A8C6QXX9_BCL2L11      SIR---------------QSQEEPADIRPEIWIAQELRRIGDEF----NA
                                                            *. :          

A0A8C6R2L6_BMF-01       ---HRLHMQQYQQNRDRAWWQVF-LFLHNLALNREGNRDGAGPR--
A0A8C6Q939_BIK-01       IWSWRFLTPVIWVSPDQACRQLLPLVLLVLLLGGALHLLPQ-----
A0A8C6RUL4_PMAIP1-      -----------------FRQKLLNLFSKLFNLIT------------
A0A8C6Q9N0_BAD-01       SFKG---LPRPKSAGTATQMRQSSSWTRIFQSWWDRNLGKGGSAPS
A0A8C6R2L6_BMF-02       ----RLHMQQYQQNRDRAWWQVF-LFLHNLALNREGNRDGAGPR--
A0A8C6QGZ2_BBC3-01      QYERRR-LEEQHRHRPSPWRAIYNLFMGLLPLPRDPRAPEMEPN--
A0A8C6QXX9_BCL2L11      -------LCSLQAK--------------------------------
A0A8C6QXX9_BCL2L11      SYPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH---------
A0A8C6QXX9_BCL2L11      SYPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH---------
                                                                      

© 1998-2023Legal notice