Dataset for protein Bmf of organism Naja naja

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        ************************************************************************
--------MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAK
mqgqeige                                                                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
QQDKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQ
                                                                                

       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
********                      *********************************
FHRLHLQRhllwtiegsaaaihnlavsryvHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
        ----------------------                                 
© 1998-2022Legal notice