Dataset for protein Bmf of organism Naja naja

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6VCH5_BMF-03      --------MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIF
A0A8C6VCH5_BMF-01      MQGQEIGEMDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIF
A0A8C6VCH5_BMF-02      --------MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIF
                               ******************************************

A0A8C6VCH5_BMF-03      TQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQTLNASSSSQDIML
A0A8C6VCH5_BMF-01      TQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQTLNASSSSQDIML
A0A8C6VCH5_BMF-02      TQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQTLNASSSSQDIML
                       **************************************************

A0A8C6VCH5_BMF-03      PCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQI
A0A8C6VCH5_BMF-01      PCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQI
A0A8C6VCH5_BMF-02      PCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQI
                       **************************************************

A0A8C6VCH5_BMF-03      ARKLQCIADQFHRLHLQR----------------------HQQNRNQVWW
A0A8C6VCH5_BMF-01      ARKLQCIADQFHRLHLQRHLLWTIEGSAAAIHNLAVSRYVHQQNRNQVWW
A0A8C6VCH5_BMF-02      ARKLQCIADQFHRLHLQRHLLWTIEGSAAAIHNLAVSRYVHQQNRNQVWW
                       ******************                      **********

A0A8C6VCH5_BMF-03      QILLFLHNLALNVEANRQRVGQR
A0A8C6VCH5_BMF-01      QILLFLHNLALNVEANRQRVGQR
A0A8C6VCH5_BMF-02      QILLFLHNLALNVEANRQRVGQR
                       ***********************

© 1998-2022Legal notice