Dataset for protein Bmf of organism Naja naja

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C6VCH5_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Naja naja GN=BMF (length=193 residues).
MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQT
LNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
>gnl|bcl2dbpro|A0A8C6VCH5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Naja naja GN=BMF (length=223 residues).
MQGQEIGEMDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAK
QQDKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQ
FHRLHLQRHLLWTIEGSAAAIHNLAVSRYVHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
>gnl|bcl2dbpro|A0A8C6VCH5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Naja naja GN=BMF (length=215 residues).
MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQT
LNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQR
HLLWTIEGSAAAIHNLAVSRYVHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
© 1998-2022Legal notice