Dataset for protein classical BH3-containing proteins of organism Myripristis murdjan

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :.*                     .:: *    . :          . .  .     .  .  .*.   .     
-----msDvesd-----------t-r--pseevGtsttgpaltpqnqnlspgvaltppplrysssg-yrLrspshvslvs
masftld gtdavfepdlhcwrt-p-eikcnds grerdksaplggkmhplsrgegtrisptnnlsrvq nfelfrhtsr
     i  e a           q f aa a  r eqcp h  nhaeggdhc h ae  e fmgaa gf  h  a fe  g

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
...   :     : :      *.     *  .    *. :      :     :   .. .. .                 
sse---ar----dgdsnpmsqRprtvpvAtwvpsryGqqltrmvdrftsehpqgehrnvrtagtv--------ww-----
kqsgylsyqqgreeeqlggrp sqsqdp rstekps rkvrlislqlhrlllklymkrshsqsplkqmqhsks--rlasa
dd elf  geee   ga feg  aqa k lqaaaki  a qhag e de  dh     q n  ha               

       170       180      
....:....|....:....|....:.
                          
--n-lf------g---hgrr------
ll-y--srqete-gtsdhpnpsrrtq
   l  dhgafa egga elhlnmie
© 1998-2020Legal notice