Dataset for protein classical BH3-containing proteins of organism Myripristis murdjan

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A667YNR9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Myripristis murdjan GN=BMF (length=163 residues).
MDDEEDDVFEPDLHCWRTTFREIKCEDRGTQTPGPALTLANGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARQ
QEREEEQNGMEQRPRQQPVARSVEARIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLASALLNLLFDRGAFAGGGGA
GRR
>gnl|bcl2dbpro|A0A667ZMY7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Myripristis murdjan GN=BCL2L11 (length=136 residues).
LSDVTAAQTPRAAPANESGGRCRGHAAPPGGKGDSPSRGAGPPISPTNSLSGYQLRSPLFRHLSRSSSGYFSYDGDSLPG
SPRPATVDKATQTPSPSGQAVTHAVLRLTEEHPHGEHRNSHTASHVDGPLPLRMIQ
>gnl|bcl2dbpro|A0A667ZNC6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Myripristis murdjan GN=BAD (length=163 residues).
MASFTISDGESDPSEEVGESETDKSLNHQEQNHHLGHALTTPELRMSASGRVRLNSESHVSTVSKDEELLARGEGEDGDG
APFRGRSQSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKRVRSAGTAKQMQHSKSWWNYLFSHQETEGETSHHENHSN
RTE
© 1998-2020Legal notice