Dataset for protein classical BH3-containing proteins of organism Myripristis murdjan

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667ZMY7_BCL2L11      -----LSDVTAA----------QTPRAAPANESGGRCRGHAAPPGGKGDS
A0A667YNR9_BMF-01       -----MDDEEDDVFEPDLHCWRTTFREIKCEDRGTQTPGPALTLANGMLP
A0A667ZNC6_BAD-01       MASFTISDGESD----------------PSEEVGESETDKSLNHQEQNHH
                             :.*                     .:: *    . :         

A0A667ZMY7_BCL2L11      PSRGAGPPISPTNSLSGYQLRSPLFRHLSRSSSGYFSY----DGDSLPGS
A0A667YNR9_BMF-01       CGVAEEPRPLFYGNAG-FRLHFPAHFELVGDQE---ARQQEREEEQNGME
A0A667ZNC6_BAD-01       LGHALTTPELRMSASGRVRLNSESHVSTVSKDEELLARGEGEDGDGAPFR
                         . .  .     .  .  .*.   .     ...   :     : :     

A0A667ZMY7_BCL2L11      PRPATVDKATQTPSPSGQAVTHAVLRLTEEHPHGEHRNSHTASHV-----
A0A667YNR9_BMF-01       QRPRQQPVARSVEARIGQKLQLIGDQFHREHLQLYHRNQRNQGPL-----
A0A667ZNC6_BAD-01       GRSQSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKRVRSAGTAKQMQH
                         *.     *  .    *. :      :     :   .. .. .       

A0A667ZMY7_BCL2L11      --------------------------DGPLPLRMIQ
A0A667YNR9_BMF-01       ---WWRLASALLNLLFDRGAFAGGGGAGRR------
A0A667ZNC6_BAD-01       SKSWW-------NYLFSHQETEGETSHHENHSNRTE
                                                            

© 1998-2020Legal notice