Dataset for protein classical BH3-containing proteins of organism Mus spicilegus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgfglarapwwlvrsgrsvapgslespeshcgrvgvggwhrgsatprararrgrrqgaaeavapagggcapatagywpra
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------p-----------------------------
rmipaaagaarargaaretfgspaergggrtgrrgaleprtrlcwqpslf-cllggdvqgsfgrrntgssegkgrtkgss
 wpgggvfwwqygcvplqlwprqldpacfavllqvtrsivvptvpp t y ytemlqrvtvrdvlspprepwrrnwe   
  a     rkgg atc g l ggga  a midklnsalhislrpkl f a ihclhlfpsrpftcdl admahh sr   
                              aaa al kg mg efa     aea  aakrd  i a   aa ga r    
                                        ca                                 q    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------mepsdvvselerd--v---lqseerppqlrpggllsaqtfpq---d-p--r-qlgppthci
pepveglakdqmawmprgrkqrpqcse-cddeggqqpsf-padge-gtq--apt-ldlea-sql-c-ls-lpvfsllgpc
        retqspfsprklmana---t----rv-g p-t-----m---va---l-----vgnpegegdtc-halrqa-l
        pasprmsqlpeft r-qinsvrtpqpp   vpedtps yep   yngspvrq drmatvsvhng--a---r-
        a al   hia ar  epekptph l l    aa qag k l   e c i hd  la  neh gef -qrwks
                e         dasce           p a a a         a        ag aaa gmet g
                          c  aa                                              r  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gp---p-------------------------------trslspaspdqsvqlpspptqapqrllyanagyr---------
adglr-isqedkaplfifvrrssllsrsssgyfsfdteqtpalmrcskgtmtvqgvgeefnhyfsgmsstglplpasfpa
-hpss gpfatrsgm                      dmdccwrqqr----vacl-ci-ihg-avty-ri-ve       
r-say rgtrpdg                        qvy t saghstsvp -- --s---r----p--          
  r   a p e e                        kpe   f   lr p   m eklqk ptrsp pv          
                                      e        ie a   a  a ag  mq a             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .*  : :..                             :                 
--------pe----vlraevriareLrrigdefnrtytrrvqqnr------drlwwqvf-lflqllalnrqln-------
gspqsqqp--gqflqhgpfrqliqk qcmaeqihelhvqqprawvhpqrkpgqadpmplncvfrnwspawyetregvgpw
   lgeee      drwiaisygas tnlr nvwswi-lshgtspsrdqdcqcgfmawy vtmlyvgg-sa-qlqstpsq
              npewlqeec q    s kl----k-------ygtntrpsqssvqt riins w-r--p-wrrme n
              eead kd          egsfeglrfpksa halqmkplrsms kl g  tfpnrgvgpeh   
                                  aq      eeq      eae npim       rdifl kad     
                                            d          hl         p   d g       
© 1998-2022Legal notice