Dataset for protein classical BH3-containing proteins of organism Mus spicilegus

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A8C6GZK8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mus spicilegus GN=BMF (length=185 residues).
MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRA
WWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A0A8C6GZK8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Mus spicilegus GN=BMF (length=185 residues).
MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRA
WWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A0A8C6GZK8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mus spicilegus GN=BMF (length=271 residues).
MPGAGVFWKQYRAVCLGLLPRQLAPAAFAAAARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLS
WSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
QNRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A0A8C6HE78_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mus spicilegus GN=BIK (length=158 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVAGENLSPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLV
QLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWIVLSPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|A0A8C6HE78_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Mus spicilegus GN=BIK (length=106 residues).
KFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWIVLSPGAWVSPD
QDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|A0A8C6HGQ3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L11 (length=214 residues).
MIPAAAGAARARGAARETFGSPAERGGGRTGRRGALEPRTRLCFPCLLGGDVQGSFDRRNTPRSEGKGRTKKDQMAKQPS
DVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRP
EIRIAQELRRIGDEFNETYTRRVRTSPHPQRKCDCGDMAPFCTLRYLSPNSALT
>gnl|bcl2dbpro|A0A8C6HGQ3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L11 (length=224 residues).
MILKLNLLKIIVLLCPPPTLFPCRKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCP
HGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQ
SQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|A0A8C6HGQ3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L11 (length=270 residues).
MIPAAAGAARARGAARETFGSPAERGGGRTGRRGALEPRTRLCFPCLLGGDVQGSFDRRNTPRSEGKGRTKKDQMAKQPS
DVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLS
RSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVR
TSPHPQRKCDCGDMAPFCTLRYLSPNSALT
>gnl|bcl2dbpro|A0A8C6HHE2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mus spicilegus GN=BBC3 (length=343 residues).
MGFGLARAPWWLVRSGRSVAPGSLESPESHCGRVGVGGWHRGSATPRARARRGRRQGAAEAVAPAGGGCAPATAGYWPRA
RWAGGAAGRWGGGCTPRQLWGGGGDRACGAVDLQVSRLGVCARVWLPSLYPYTEMLAFVTRRGVCAPGSAMARARQEGSS
PEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRP
DGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRV
MYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|A0A8C6HML5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus spicilegus GN=PMAIP1 (length=103 residues).
MPRRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKGRMRSPSPTRVPADLKDECAQLRR
IGDKVNLRQKLLNLISKLFNLVT
>gnl|bcl2dbpro|A0A8C6IHC9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mus spicilegus GN=BAD (length=204 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPG
LLGSIVHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGLPRPKSAGTATQMRQSSSWTRIIQSWWDRNLGKGDSTPSQ
© 1998-2022Legal notice