Dataset for protein classical BH3-containing proteins of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6HE78_BIK-01       --------------------------------------------------
A0A8C6HE78_BIK-02       --------------------------------------------------
A0A8C6HML5_PMAIP1-      --------------------------------------------------
A0A8C6HHE2_BBC3-01      MGFGLARAPWWLVRSGRSVAPGSLESPESHCGRVGVGGWHRGSATPRARA
A0A8C6IHC9_BAD-01       --------------------------------------------------
A0A8C6HGQ3_BCL2L11      --------------------------------------------------
A0A8C6HGQ3_BCL2L11      --------------------------------------------------
A0A8C6HGQ3_BCL2L11      --------------------------------------------------
A0A8C6GZK8_BMF-02       --------------------------------------------------
A0A8C6GZK8_BMF-03       --------------------------------------------------
A0A8C6GZK8_BMF-01       --------------------------------------------------
                                                                          

A0A8C6HE78_BIK-01       --------------------------------------------------
A0A8C6HE78_BIK-02       --------------------------------------------------
A0A8C6HML5_PMAIP1-      --------------------------------------------------
A0A8C6HHE2_BBC3-01      RRGRRQGAAEAVAPAGGGCAPATAGYWPRARWAGGAAGRWGGGCTPRQLW
A0A8C6IHC9_BAD-01       --------------------------------------------------
A0A8C6HGQ3_BCL2L11      --------------------------------------------------
A0A8C6HGQ3_BCL2L11      -------------------------------MIPAAAGAARARGAARETF
A0A8C6HGQ3_BCL2L11      -------------------------------MIPAAAGAARARGAARETF
A0A8C6GZK8_BMF-02       --------------------------------------------------
A0A8C6GZK8_BMF-03       --------------------------------------------------
A0A8C6GZK8_BMF-01       -------------------------------MPGAGVFWKQYRAVCLGLL
                                                                          

A0A8C6HE78_BIK-01       --------------------------------------------------
A0A8C6HE78_BIK-02       --------------------------------------------------
A0A8C6HML5_PMAIP1-      --------------------------------------------------
A0A8C6HHE2_BBC3-01      GGGGDRACGAVDLQVSRLGVCARVWLPSLYPYTEMLAFVTRRGVCAPGSA
A0A8C6IHC9_BAD-01       --------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSD
A0A8C6HGQ3_BCL2L11      ---------MILKLNLLKIIVLLCPPPTLFPC------------------
A0A8C6HGQ3_BCL2L11      GSPAERGGGRTGRRGALEPRTRLC-----FPCLLGGDVQGSFDRRNTPRS
A0A8C6HGQ3_BCL2L11      GSPAERGGGRTGRRGALEPRTRLC-----FPCLLGGDVQGSFDRRNTPRS
A0A8C6GZK8_BMF-02       --------------------------------------------------
A0A8C6GZK8_BMF-03       --------------------------------------------------
A0A8C6GZK8_BMF-01       PRQLAPAAFAAAARATASHRSPLEFAPF-FPIECGHQAPRVFFTLDPGAE
                                                                          

A0A8C6HE78_BIK-01       ------------------------MSEARLMARDVIKTVPHDQVPQPPVA
A0A8C6HE78_BIK-02       ----------------------------KFTRN-----------------
A0A8C6HML5_PMAIP1-      ------------------------MPRRKARRNAPVNPTRAELPP-----
A0A8C6HHE2_BBC3-01      MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPG-----LP
A0A8C6IHC9_BAD-01       AGGRRWR-----------PAAQSMFQIPEFEPSEQEDASATDRGLGPSLT
A0A8C6HGQ3_BCL2L11      -----RK-----------KDQMA------KQPSDVSSECDREGGQ---LQ
A0A8C6HGQ3_BCL2L11      EGKGRTK-----------KDQMA------KQPSDVSSECDREGGQ---LQ
A0A8C6HGQ3_BCL2L11      EGKGRTK-----------KDQMA------KQPSDVSSECDREGGQ---LQ
A0A8C6GZK8_BMF-02       -----------------------------MEPPQCVEELEDD--V---FQ
A0A8C6GZK8_BMF-03       -----------------------------MEPPQCVEELEDD--V---FQ
A0A8C6GZK8_BMF-01       PWHHNSE-----------AETLSWSHPGEMEPPQCVEELEDD--V---FQ
                                                                          

A0A8C6HE78_BIK-01       SETPSMKEPVAGENLSPVRDVDLMECVEGRNQVALRLACIGD--------
A0A8C6HE78_BIK-02       -------------------------------QVALRLACIGD--------
A0A8C6HML5_PMAIP1-      -------------------------------EFAAQLRKIGD--------
A0A8C6HHE2_BBC3-01      AAPAAPALLPAAYLCAPTAP------PAVTAALGGPRWPGGHRSRPRGPR
A0A8C6IHC9_BAD-01       EDQPGPYLAPG-LLGSIVHQQGRAATNSHHGGAGAMETRSRHSSYPAGTE
A0A8C6HGQ3_BCL2L11      PAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFA
A0A8C6HGQ3_BCL2L11      PAERPPQLRPGAPTSLQTEPQ-----------------------------
A0A8C6HGQ3_BCL2L11      PAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFA
A0A8C6GZK8_BMF-02       SEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQE
A0A8C6GZK8_BMF-03       SEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQE
A0A8C6GZK8_BMF-01       SEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQE
                                                                          

A0A8C6HE78_BIK-01       ---------------------------EMDLCLRSPR----LVQLPGIAI
A0A8C6HE78_BIK-02       ---------------------------EMDLCLRSPR----LVQLPGIAI
A0A8C6HML5_PMAIP1-      ---------------------------KVYCTWSAPDITVVLAQMPGKSQ
A0A8C6HHE2_BBC3-01      PDGP-----------------------QPSLSPAQQHLESPVPSAPEALA
A0A8C6IHC9_BAD-01       EDEGM----------------------EEELSPFRGRSRSAPP-------
A0A8C6HGQ3_BCL2L11      TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
A0A8C6HGQ3_BCL2L11      ---------------------------DRSPAPMSCDKSTQTPSPPCQAF
A0A8C6HGQ3_BCL2L11      TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
A0A8C6GZK8_BMF-02       DKA------------------------TQTLSPASPSQGVMLPCGVTEEP
A0A8C6GZK8_BMF-03       DKA------------------------TQTLSPASPSQGVMLPCGVTEEP
A0A8C6GZK8_BMF-01       DKA------------------------TQTLSPASPSQGVMLPCGVTEEP
                                                                          

A0A8C6HE78_BIK-01       HRLAVTYSRTG-----------------------VRGIFRSLIRSLTNLR
A0A8C6HE78_BIK-02       HRLAVTYSRTG-----------------------VRGIFRSLIRSLTNLR
A0A8C6HML5_PMAIP1-      KGRMRSPSPTR-----------------------VPADLKDECAQLRRIG
A0A8C6HHE2_BBC3-01      GGPTQAAPGVRVE---------------------EEEWAREIGAQLRRMA
A0A8C6IHC9_BAD-01       ----------------------------------NLWAAQRYGRELRRMS
A0A8C6HGQ3_BCL2L11      NHYLSAMASIR------------QSQEEPE----DLRPEIRIAQELRRIG
A0A8C6HGQ3_BCL2L11      NHYLSAMASIR------------QSQEEPE----DLRPEIRIAQELRRIG
A0A8C6HGQ3_BCL2L11      NHYLSAMASIR------------QSQEEPE----DLRPEIRIAQELRRIG
A0A8C6GZK8_BMF-02       QRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIA
A0A8C6GZK8_BMF-03       QRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIA
A0A8C6GZK8_BMF-01       QRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIA
                                                                    .*  : 

A0A8C6HE78_BIK-01       ENIWSWIVLSPGAWVSPDQDPGQLFPMVL-LVFLLLGGAWYLQLQ-----
A0A8C6HE78_BIK-02       ENIWSWIVLSPGAWVSPDQDPGQLFPMVL-LVFLLLGGAWYLQLQ-----
A0A8C6HML5_PMAIP1-      DKV---------------NLRQKLLNLIS-KLFNLVT-------------
A0A8C6HHE2_BBC3-01      DDLNAQYERRRQEEQHRHR--PSPWRVMYNLFMGLLPLPRDPGAPEMEPN
A0A8C6IHC9_BAD-01       DEFEGSFKGLPRPKSAGTATQMRQSSSWT-RIIQSWWDRNLGKGDSTPSQ
A0A8C6HGQ3_BCL2L11      DEFNETYTRRVFANDYR----EAEDHPQM-VILQLLRFIFRLVWRRH---
A0A8C6HGQ3_BCL2L11      DEFNETYTRRVRTSPHPQRKCDCGDMAPF-CTLRYLSPNSALT-------
A0A8C6HGQ3_BCL2L11      DEFNETYTRRVRTSPHPQRKCDCGDMAPF-CTLRYLSPNSALT-------
A0A8C6GZK8_BMF-02       DQFHRLHTQQHQQNR------DRAWWQVF-LFLQNLALNRQENREGVGPW
A0A8C6GZK8_BMF-03       DQFHRLHTQQHQQNR------DRAWWQVF-LFLQNLALNRQENREGVGPW
A0A8C6GZK8_BMF-01       DQFHRLHTQQHQQNR------DRAWWQVF-LFLQNLALNRQENREGVGPW
                        :..                             :                 

© 1998-2022Legal notice