Dataset for protein Bik of organism Mus spicilegus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       *************************
----------------------------------------------------vftRNQVALRLACIGDEMDLCLRSPRLV
msearlmardviktvphdqvpqppvasetpsmkepvagenlspvrdvdlmeckeg                         

        90       100       110       120       130       140       150        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
******************************************************************************
QLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWIVLSPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
                                                                              
© 1998-2022Legal notice