Dataset for protein Bik of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6HE78_BIK-01      MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVAGENLSPVRDVDLM
A0A8C6HE78_BIK-02      --------------------------------------------------
                                                                         

A0A8C6HE78_BIK-01      ECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVR
A0A8C6HE78_BIK-02      --KFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVR
                            *********************************************

A0A8C6HE78_BIK-01      GIFRSLIRSLTNLRENIWSWIVLSPGAWVSPDQDPGQLFPMVLLVFLLLG
A0A8C6HE78_BIK-02      GIFRSLIRSLTNLRENIWSWIVLSPGAWVSPDQDPGQLFPMVLLVFLLLG
                       **************************************************

A0A8C6HE78_BIK-01      GAWYLQLQ
A0A8C6HE78_BIK-02      GAWYLQLQ
                       ********

© 1998-2022Legal notice