Dataset for protein Bik of organism Mus spicilegus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C6HE78_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mus spicilegus GN=BIK (length=158 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVAGENLSPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLV
QLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWIVLSPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|A0A8C6HE78_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Mus spicilegus GN=BIK (length=106 residues).
KFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWIVLSPGAWVSPD
QDPGQLFPMVLLVFLLLGGAWYLQLQ
© 1998-2022Legal notice