Dataset for protein Noxa of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 ***.. . *  . .***  ************
-------------------------------------------------MPGksqksRmrspsPTRvpADLKDECAQLRR
mpgrkarrnapvnptraelppefaaqlrkigdkvyctwsapditvvlaq   rkar- napvn   --            

        90       100   
....:....|....:....|...
***********************
IGDKVNLRQKLLNLISKLFNLVT
                       
© 1998-2021Legal notice