Dataset for protein Noxa of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 *******************************
-------------------------------------------------MPGKSQKSRMRSPSPTRVPADLKDECAQLRR
mpgrkarrnapvnptraelppefaaqlrkigdkvyctwsapditvvlaq                               

        90       100   
....:....|....:....|...
***********************
IGDKVNLRQKLLNLISKLFNLVT
                       
© 1998-2020Legal notice