Dataset for protein Noxa of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q9JM54_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus musculus GN=PMAIP1 (length=103 residues).
MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRR
IGDKVNLRQKLLNLISKLFNLVT
>gnl|bcl2dbpro|Q9JM54_PMAIP1-03 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus musculus GN=PMAIP1 (length=54 residues).
MPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
© 1998-2020Legal notice