Dataset for protein Noxa of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9JM54_PMAIP1-01      MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQM
Q9JM54_PMAIP1-02      -------------------------------------------------M
Q9JM54_PMAIP1-03      -------------------------------------------------M
                                                                       *

Q9JM54_PMAIP1-01      PGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFN
Q9JM54_PMAIP1-02      PGRKAR-RNAPVNPTR--ADLKDECAQLRRIGDKVNLRQKLLNLISKLFN
Q9JM54_PMAIP1-03      PGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFN
                      **.. . *  . .***  ********************************

Q9JM54_PMAIP1-01      LVT
Q9JM54_PMAIP1-02      LVT
Q9JM54_PMAIP1-03      LVT
                      ***

© 1998-2022Legal notice