Dataset for protein classical BH3-containing proteins of organism Moschus moschiferus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
makqpsdvssecdreggqlqpaerppqlrpgaptslqterqgnpepgdrcpqglprgplaapaspgpftdatrsplfifp
  rarqeg  pepv  lardmprpfelsqsepsqvspglvrdglsearag ptssqayftpdttlqsvlaslwvrrwpg 
                    gfqi  fe mvqedcveedegpvfqatpge gqq ksw s  llapeq  cpla hql  
                             l   a  ca celtap egda cl  ahl c  gf  aa    g       
                                        da         a     f                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------mpgrrdrrsaqpspprvaadpevecaas-----a---------w------
lthccgpvrrssslsrsssgyfsfdtdrspalmscakstqtqvlacqgfnhylsami-mrqsq-vpadtrpeq-ahraei
       gqqptlrgsrptqtl pasppqgs-spasqhleslrgsapp-g----llgggptqarpgvrgpeni qaq   
       hp grpqepqir        st -v---e---sy c tydqr-yrevdpcpfgrrsprsssae gl       
        l  q a dkhh        g  vmlt -vtemp a lhrne tpap    a gllll eqpq          
                 ad             e  g    c   fegd            agg    a            
                                                                                

       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
      . :.*.::                                                   
-ia-qLrrigDelnary--------rr-----q-----pw-----klvnliskllrsgt------
e--qewqcma kfhfyqmwrrrprp--vqvhq-rrrps--rvllr-iry-vrlvggrq-pevepn
rygar kals d  vlt  kgla eksrfeehaahaghwqmrfynv-mgrlpfpw-m-asqag r
qt rk      q  rsh       s  aptpt natyws tiaaqlwl-n-a---d-rrng    
l             q f          mgqag mpqsv  qc  asv-s n-wr  enpl     
                           l a   l nrp  l    qfah algn   an      
                                     e          a                
© 1998-2023Legal notice