Dataset for protein classical BH3-containing proteins of organism Moschus moschiferus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------g----------l----------------------------------------------
mfqpqemakqpsdvsspcdreg-qlqpaerppq-rpgaptslqterqgnpeegdrcpqgspqgplappaspgpfatrspl
 epipcveraeqegfreeppvlptaptslwvfpqsrqwqsavslsglqlhqqtqsagpslrpttqedkltqtlypcsptt
      fvqstd daqaaegqp rsrrgplsah iklvlpdppcl eagfpl hl es hhgasa  a l aaslaa sq
        elra a     cge pqff dg  g fahs l cg          gc      a                  
                       l  d     d    p                                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------mpgrrsrrspspspqrvnhdpeaeaai----a-------e-w---
fifvrrssllsrsssgyfsfdtdrspapdgpqpslsscekatqtaqlpcaaf-aylsvmcsmrqsq-vpadtrp-q-aar
pvm taalgap wpg   prsrp g r        --adqhle-svyfapg-p----lleggptqrppgvsgpeqi qrq
gpa                                la------pqr cygprgrrgpev dlsagalrsrrseanl  he
                                   g vgvts hmc   tneqyg t p  fgpflglleqpa g     
                                       tre       lhddde      c     g   a        
                                                   aa                           

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
         . :.*.::                                                    
----ia-qLrrigDelnary----r------------p----------klvnllskllgsgt-------
aeir--qewqcma kfhfyqmwrp-rrsvhqqaqrrs-qrvlylcaaarvlryivrfvrrrgapevepn
   qygar kals d  vltkgle pvqeehprhaphswmwtl     n-img-lp-pwgmqsnpsq r
   et rk      q  rsh   r alfrrthtangqrvy qw     - ---n--n----nragag  
                 q f      k mqaaqpman tw pr     q qswaaw n de-l      
                            ag    g l ps  i     l flh  a             
                                    e           f aa                 
© 1998-2022Legal notice