Dataset for protein classical BH3-containing proteins of organism Moschus moschiferus

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A8C6CNS6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQLSPARVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A8C6CSS1_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Moschus moschiferus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTTPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A8C6CSS1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Moschus moschiferus GN=BBC3 (length=131 residues).
VRATAEAARACPCQLPRAFFSLWVPHQIRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A8C6CWP8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Moschus moschiferus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A8C6D4Q6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPARDQRDPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A8C6DRY6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVHHQAAAGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A8C6DRY6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L11 (length=194 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRR
SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYY
PRRVFVHHQAAAGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A8C6DRY6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRR
SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYY
PRRLEPQ
>gnl|bcl2dbpro|A0A8C6E5X8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Moschus moschiferus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8C6ECQ4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPTRVPADPEVECAIQWRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A8C6FXQ6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Moschus moschiferus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDGPPGLSKHWLTAPGLLGEAGHQQGQSAGSSHHGGTGAVETRSRHSSYPAGP
EDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
>gnl|bcl2dbpro|A0A8C6FY79_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRSRRSAQPSPARVAADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
© 1998-2022Legal notice