Dataset for protein classical BH3-containing proteins of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6CSS1_BBC3-01      -------VRATAEAARACPCQLPRAFFSLWVPHQIRGPQPSL--------
A0A8C6CWP8_BMF-01       MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLF
A0A8C6FXQ6_BAD-01       MFQIPEFEQSEQEDSSPADRGLGPSPTGDGPPGLSKHWLTAPGLLGEAGH
A0A8C6DRY6_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---
A0A8C6CSS1_BBC3-02      ------MARARQEGSSP-EPVEGLARDGPRPFPLSRLVPSAVSC------
A0A8C6DRY6_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNP
A0A8C6DRY6_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNP
A0A8C6E5X8_HRK-01       --------------------------------------------------
A0A8C6ECQ4_PMAIP1-      --------------------------------------------------
A0A8C6CNS6_PMAIP1-      --------------------------------------------------
A0A8C6FY79_PMAIP1-      --------------------------------------------------
A0A8C6D4Q6_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C6CSS1_BBC3-01      --------------------------------------------------
A0A8C6CWP8_BMF-01       PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVM-----------------
A0A8C6FXQ6_BAD-01       QQGQSAGSSHHGGT------------------------------------
A0A8C6DRY6_BCL2L11      --------------------------------------------------
A0A8C6CSS1_BBC3-02      ---GLCEPGLPAAPAAPALLPAAYLCAPTTPPAVTAALGAPRWPGG--PR
A0A8C6DRY6_BCL2L11      EEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSF
A0A8C6DRY6_BCL2L11      EEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSF
A0A8C6E5X8_HRK-01       --------------------------------------------------
A0A8C6ECQ4_PMAIP1-      --------------------------------------------------
A0A8C6CNS6_PMAIP1-      --------------------------------------------------
A0A8C6FY79_PMAIP1-      --------------------------------------------------
A0A8C6D4Q6_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C6CSS1_BBC3-01      ---------------SPAEQHLESPVPSAPG------ALAGGPTQAAPGV
A0A8C6CWP8_BMF-01       ---------------LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGE
A0A8C6FXQ6_BAD-01       ---------------GAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSR
A0A8C6DRY6_BCL2L11      --DRSPAP-------MSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPA
A0A8C6CSS1_BBC3-02      SRPRGPRPDGPQPSLSPAEQHLESPVPSAPG------ALAGGPTQAAPGV
A0A8C6DRY6_BCL2L11      DTDRSPAP-------MSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPA
A0A8C6DRY6_BCL2L11      DTDRSPAP-------MSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPA
A0A8C6E5X8_HRK-01       ------------------------MCPCPLHRGRGPPAVCACSAGRLGLR
A0A8C6ECQ4_PMAIP1-      ---------------MPGRRARRSAQPSPTRVPADPEVECAI--------
A0A8C6CNS6_PMAIP1-      ---------------MPGRRARRSAQLSPARVPADPEVECAI--------
A0A8C6FY79_PMAIP1-      ---------------MPGRRSRRSAQPSPARVAADPEVECAI--------
A0A8C6D4Q6_PMAIP1-      ---------------MPGRRARRSAQPSPARDQRDPEVECAI--------
                                                                          

A0A8C6CSS1_BBC3-01      RGEEEQWARE----IGAQLRRMADDLNALY---ERRRQEEQQRHRPSPWR
A0A8C6CWP8_BMF-01       QPPEGQWQHRAEIQIARKLQCIADQFHRLH--------MQQHQQNRNRVW
A0A8C6FXQ6_BAD-01       SAPPNLWAAQ---RYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPS
A0A8C6DRY6_BCL2L11      DTRPEIW-------IAQELRRIGDEFNAYY---PRRVFVHHQAAAGHPQM
A0A8C6CSS1_BBC3-02      RGEEEQW-AR---EIGAQLRRMADDLNALY---ERRRQEEQQRHRPSPWR
A0A8C6DRY6_BCL2L11      DTRPEIW-------IAQELRRIGDEFNAYY---PRRVFVHHQAAAGHPQM
A0A8C6DRY6_BCL2L11      DTRPEIW-------IAQELRRIGDEFNAYY---PRRL---------EPQ-
A0A8C6E5X8_HRK-01       SSAAQL--------TAARLKALGDELHQRTMWRRRARSRRAPAPGALPTY
A0A8C6ECQ4_PMAIP1-      -----------------QWRRIGDKLNFRQ--------------------
A0A8C6CNS6_PMAIP1-      -----------------QLRRIGDKLNFRQ--------------------
A0A8C6FY79_PMAIP1-      -----------------QLRRIGDKLNFRQ--------------------
A0A8C6D4Q6_PMAIP1-      -----------------QLRRIGDKLNFRQ--------------------
                                           . :.*.::                       

A0A8C6CSS1_BBC3-01      VLY-----NLIMGLLPFPGGRGAPEVEPN
A0A8C6CWP8_BMF-01       WQI-----LLFLHNVALNGDENRNGAGPR
A0A8C6FXQ6_BAD-01       WTR-----FLQSWLSRNLGRGGSAPSQ--
A0A8C6DRY6_BCL2L11      VLL-----RVLRYLVRLVWRMQ-------
A0A8C6CSS1_BBC3-02      VLY-----NLIMGLLPFPGGRGAPEVEPN
A0A8C6DRY6_BCL2L11      VLL-----RVLRYLVRLVWRMQ-------
A0A8C6DRY6_BCL2L11      -----------------------------
A0A8C6E5X8_HRK-01       WPWLCAAAQVAALAAWLLGRRNL------
A0A8C6ECQ4_PMAIP1-      --------KLVNLISKLLRSGT-------
A0A8C6CNS6_PMAIP1-      --------KLVNLISKLLRSGT-------
A0A8C6FY79_PMAIP1-      --------KLVNLISKLLRSGT-------
A0A8C6D4Q6_PMAIP1-      --------KLVNLISKLLRSGT-------
                                                     

© 1998-2022Legal notice