Dataset for protein classical BH3-containing proteins of organism Monodon monoceros

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssp-dreggqlqpaerpp-l-------------rpgapislqterq--------------------
mfqpqe----------ec--------------q-srlvpsavscglc-------p-----gppeglgdrgpqpspqgpla
 epipcverseqegfq-eepvp tsptgplsfp            faqsqlrvr-srpqltnltyecgpclrgtvtasss
      f qlrd d   a ggl pqrgsl  ad              m  rdcpkakla laaglc eathpqgspedkg
        ea           e la d d                  e    ag  ah  f  ah  a  a  aq  a  
                                                     a                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         .                                      
-----g----r-------------------------drspapmscdkstqtpsppcqafnhy-s--a--rqsqa-p---r
ppasp-pfat-splfifvrrssllsrsssgyfsfdt-mqsysagtpagppveeqi-eg----l-am-sm---r-v-adm-
tqtwtpavrsqg    vmlpcgvteepqrlfygnagyhlqs trrqrelspvcahs--rwqsrpsalqlgrt-sa pvrw
hhrls gsp                           sag r lhpgpdeglg eepssqvpla g  agtpa    gnlg
a gg   pe                           r c l d fed  eaa  claplrgh        a         
                                    p   c   a          a   l                    

       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
            :. :.*.::                                                   
peiwiare----lrrigDefnayyprr-------------qm---r-l--i-rllwrmq-------------
------q-igaqfqama qlhrrtm--vflnnrqaaeghp--viw-v-rh-vq-v-nlallrgsptpsqnpr
aavqyg-k     k ls k  qlq-wqrrqrshrspqtshrptylplwyrll-v-nl--wglrrrrngpg  
e rrw             d  gshkq leaprpneegqrtlqsrs w wqfimswl-rsrngdgnnmea   
  e                  f feg          apaa  rqn s tnaalgahpipk f egel     
                                          np    ca  kf a an    a a      
© 1998-2023Legal notice