Dataset for protein classical BH3-containing proteins of organism Monodon monoceros

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4U1FMC3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Monodon monoceros GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHRQTAPGLLGEAGHQQGQPASSSHHGGTGAVETRSRHSSYSAGT
EDEEGTEEEEPSPFRGRSRSAPPNLWAARRYGRELRRMSDEFHGSFKGLPRPNSAGTATQMRQSPSWTRFLQSWWNRNLG
RGGPAPSQ
© 1998-2021Legal notice