Dataset for protein classical BH3-containing proteins of organism Monodon monoceros

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6B0J8_BMF-01       MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADL-----------FAQSQ
A0A8C6AG09_BBC3-01      ------MARARQEGSSP-EPVEGLARDGPRPFPLSRLVPSAVSCGLCEPG
A0A4U1FMC3_BAD-01       MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPP------------------
A0A8C6C635_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQL-------------RPG
A0A8C6C635_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQL-------------RPG
A0A8C6C635_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQL-------------RPG
A0A8C6AVV0_PMAIP1-      -----------------------------------------------MPG
A0A8C6F0V7_HRK-01       --------------------------------------------------
                                                                          

A0A8C6B0J8_BMF-01       LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG----VMLP
A0A8C6AG09_BBC3-01      LPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGGPRSR---------
A0A4U1FMC3_BAD-01       ---GPSKHRQTAPGLLGEAGHQQGQPASSSHHGGTGAVETRS--------
A0A8C6C635_BCL2L11      APISLQTERQ----------------------------------------
A0A8C6C635_BCL2L11      APISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A8C6C635_BCL2L11      APISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A8C6AVV0_PMAIP1-      RRVRK---------------------------------------------
A0A8C6F0V7_HRK-01       --------------------------------------------------
                                                                          

A0A8C6B0J8_BMF-01       CGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPAEGQWQH--------
A0A8C6AG09_BBC3-01      ----------------PRGPRPDGPQPSLSPAEQHLESLVPSAPGALAGG
A0A4U1FMC3_BAD-01       ----------------RHSSYSAGTEDEEGTEEEEPSPFR---------G
A0A8C6C635_BCL2L11      ----------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8C6C635_BCL2L11      SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8C6C635_BCL2L11      SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8C6AVV0_PMAIP1-      ----------------SAQQSPTRAPADPEVECAI---------------
A0A8C6F0V7_HRK-01       -----------------MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLT
                                             .                            

A0A8C6B0J8_BMF-01       ---------RAEVQIARK----LQRIADQFHRLHMQQ------------H
A0A8C6AG09_BBC3-01      PTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERR-----RQEEQQRH
A0A4U1FMC3_BAD-01       RSRSAPPNLWAARRYGRE----LRRMSDEFHGSFKG---LPRPNSAGTAT
A0A8C6C635_BCL2L11      QSQAVPADMRPEIWIAQE----LRRIGDEFNAYYPRRVFLNNHQAAEGHP
A0A8C6C635_BCL2L11      QSQAVPADMRPEIWIAQE----LRRIGDEFNAYYPRRLEQ----------
A0A8C6C635_BCL2L11      QSQAVPADMRPEIWIAQE----LRRIGDEFNAYYPRRVFLNNHQAAEGHP
A0A8C6AVV0_PMAIP1-      --Q-------------------FRRIGDKLNFRQ----------------
A0A8C6F0V7_HRK-01       AAR-------------------LKALGDELHQRTMWRRRARSRRAPAPSA
                                              :. :.*.::                   

A0A8C6B0J8_BMF-01       QQNRNRVWWQILLFLHNLALNGDENRNGAGPR
A0A8C6AG09_BBC3-01      RPSPWRVLYNLIMGLLPLPRGRGAPEMEPN--
A0A4U1FMC3_BAD-01       QMRQSPSWTRFLQSWWNRNLGRGGPAPSQ---
A0A8C6C635_BCL2L11      QMVILRLLRHIVRLVWRMQ-------------
A0A8C6C635_BCL2L11      --------------------------------
A0A8C6C635_BCL2L11      QMVILRLLRHIVRLVWRMQ-------------
A0A8C6AVV0_PMAIP1-      ------------KLLNLISKLFRSGT------
A0A8C6F0V7_HRK-01       LPTYWPWLCAAAQVAALAAWLLGRRNL-----
                                                        

© 1998-2023Legal notice