Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m------p------------------------------------------------------------------------
-avqltq-sgapwrpkqergggaggrsrgtehraratgrvvfqglgvglrsgecaprlgvrvpcrergplsprcccrcec
 tks   at  glp epag      eap aag                                                
 gpr    r                                                                       
 c c    l                                                                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------e--rdgsspepve--pptqp-------------------qg
gaglgklrrgrhrgvgpplvcscslsvslrrlpphlgns-cqqe-gqlq-t-glrres-rtfplgrlmpsavscslceaq
           a  ra  at aah      me  dy maradd-v----es   ----                    --
                                   w ve le-lafh rd-   tgsw                    gd
                                             aa         a                     d 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               .
l-r-sapt--qtqypg--l-gssl-p---------------------------------r-----------rspa-gsqg
-nppggdssimcpaq-pa-d----l-sspqgpfapptspsplatrsplfyfctrsplqp-syggprwarad----pmncd
at- ---fq -----dysgaplqrs                ft      iclrp   ll avsqyfsfttal   a--s 
 ss vsm-  pqsq  nqee decf                        h  g    g   s  edk dqt    spqp 
    a l   aefe  em      a                                                       
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .                                                                          
qsgqlpsppprafqhegsq--mg-p------p------a--rlgpeip-dq-e-rqe----------------------r
kptsts-lg-qsaneylgalfe-e-qgasys-msggppgsmvqsqshga--g-mqpdaeedrglfrsrsssappilwaai
vm--raaaac---------  -rrqryr  p lresfa- l-------ee w h-aa                      v
rler   -- ggvt  phr  y nagli  l  pa   v  ev e p  a a   -                       q
g         c qr   ag  d k dh                   a                                 
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  . .*: :.*::.                  :                                               
wiaqeLrrmgDefnasyy------------qrrr-----rrhv----------------wrllynlg----a-------p
eygaq qcia dlqrltmglprpksagtaspmhqeeeqs---laeaagsgggglpayspl-c-ryqisgll-pqrrnrm-
rt sr kals herhe            w  gshqw tntf              ww qngnshvna a ln eenrn
  k        dc fk               a  gr   aa              qs liflffha          ki
                                  an                    a hfaka              g
                                                            d  a               a

       410       420   
....:....|....:....|...
                       
gvgp------------------n
dae-qmvilwllryiirlvwrnl
---ss    r         r mr
 dhh                  q
                      h
                       
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice