Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgvrprgapwrpepaggggaggrargtagraratgrvvfqglgvglrsgecaprlgvrvpcrergplsprcccrcecgag
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------qa---gs-pepegg------r-fqpgrlrpgavtssltqa---p
lgklrrgrargvappltcsahlsvslrrlpptwmmk--sql--scdrve-qprptp-t-plqq-m-s-psciqceygln-
                              mhvsaarpqddnle-----yllqesedpt----s- - --------qgfs
                                 glt  tga  pmkqpr veeled v hgeges   qprg as a  a
                                                h          g  d e   ehgd  a     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        ..   .                  
--------------------p-pal-psslfpl--f-----r---gp--a-qdrspapgsqgqsgstpsppprarqhygs
sgdsmcspsspqgpfappta-g---a-------ay-ctrqp-syg--rw-raasercamncdkptqlvvlgcqsfneelg
resetpp            w dymstrvqmlqitrrsppll avsqygsqt--mc  spqr vmpprscaesshalfqra
qsgds              s sdfarglp  ifphc glg   s eefkfettl    lhp rglrcg tcepdqr   n
g                  q     d       le            de ddg         g   a   a g       
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          .  *. :.*::           
amg-----gsspqsqsppavlrpe-----e-------------------------rwiaqeLrrmgDefnasyy------
qe-epqliaamrm-ggi-gdmg--hgdqg-qqehreerglfrsrsssappilwaaieygaq qcia dlqrltmgwrrrp
ggrrqrh ----lr---a----lgeeppe rwdaead                  vrt sr kals herhe lp pk
 dak d  yyp -pe f vsv   a a a  a                       qq   k        dc fk     a
 a a    srl   a    e                                    l                       
                                                                                

       330       340       350       360      
....:....|....:....|....:....|....:....|....:.
                                              
------q-rrghgqrrhlvpwrllynlisgvlapqr----------
rsgtas-r-qeee--ptvsyl-wgryigr-lasqs-rnrrpdvepn
srrrldnny----wthrraw qiflsfhnv-wrmnwllnmrnlg r
 a f aamaassqgngqpqv hf kfaaklgglllhee  nga   
       e  ra dh nm s ac ca  i a gaa           
              g lh i        h                 
© 1998-2022Legal notice