Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgvrprgapwrpepaggggaggrargtagraratgrvvfqglgvglrsgecaprlgvrvpcrergplsprcccrcecgag
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 ...            
-----------------------------------krpqqlgse-e---glprpserptqpgrlrpgavtc---------
lgklrrgrargvappltcsahlsvslrrlpphwmmaqasddn--p-rvg-qlqetpptfplqqgmssvpssiqtqyqgns
                                mta-------escdpeef---mq cg-hr get a lhr         
                                 gvsltphyva l ddv h pkc   lgg   s   efa         
                                   me  at           ed    a     p   ca          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------p-pal-psslfpl--f-----r---gp--a--drspapgsqgqsgstpsppprafqhygs
gegslceaglnpsgdsmpsa-g---a-------ay-ctrqp-syg--rw-raa----amncdk-tql--lgcqsaneelg
   dsaspsspqrpsetcpw dymstrvqmlqitrrsppll avsqygsqtt-ser ------p---sv-----------
      a     gefapqts sdfarglp  ifphc glg   s eefkfeqtl   spqp vmlrrg teephrrf  n
                   q     d       le            de ddg         g  pc  aa g ql   a
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 .                                        .  *. :.*::           
am------sssplsqsppavlrpe-----e-------------------------rwiaqeLrrmgDefnasyy---r--
qegepqligamrqrggiagdmg--hgdqg-qqehreerglfrsrsssappilwaaieygaq qcia dlqrltmgwp-rk
--rrqrh ayp mperf vsv-lgeeppe rwdaead                  vrt sr kals herhe lr pg
gg k d  yrl  ea a  ea   a a a  a                       qq   k        dc fk     a
 d        d        a                                    l                       
                                                                                

       330       340       350       360      
....:....|....:....|....:....|....:....|....:.
                                              
------qrrrehgqrrhlspwrllynlisgllapq-----------
ssrtay--a--ee--v--qyl-firsfgwvva---rrnrmrdvepn
rlgrnsam-qs--wt-wwav lygkraalrrqsqswllgrpnl   
fadn a ghgqsrnmgtvrs hwfia vknmglnrnga p      
       e agnhgh lp l ac h   i gegalh          
          d   g i  i    c   h a e a           
© 1998-2022Legal notice