Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m---p---------------------------------------------------------------------------
-akq-sdlpwrpepaggggaggrargtagraratgrvvfqglgvglrsgecaprlgvrvpcrergplsprcccrcecgag
 gvr rga                                                                        
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------nsrcqregsspqpve-------rttqpqrlrpsavtssqtq--g--
lgklrrgrargvappltcsahlsvslrrlpphwgmaeadqd-gqle-t-glpresp-pfplgq-m-g-pscilceya-ln
                                  ------- ---- -         ------ - - ------- q ns
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      :       .  . .:.  *     * 
--gdsmcpap--gp---p-s--p-a---------------------yfctrqpraygppswdrstqtpaapnQgqshyLs
ps--------pq--ala-s-ll-l-trsplfiflrrspllprsssgl----tdpspagmrcakaarsaspgc afngs p
ge   cs ss    fap t ps f                       hsgdg   vcac s  le r   aa ltaar k
        c                                       rf                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
::                                        :       ** . . .*                     
algp---qsmrqsqsipqgmsp--------------------erwigqqlRRmadelnAsyeqrr-------rgegqrrh
sm--rsaaeeggqege-adar-msggppgvlgpehgdqgeqqdieeaaew  igrdfr laypaggfldnny-e-e----
   kqdh--------- ----                      lq rtm   r  sr  a  a         s-g-glpq
   d                                                                    q a dhha

       330       340         
....:....|....:....|....:....
             :               
lspwrllynlisgllapq-r-r-------
-wvllcfryivrlvwswlr-n-mpdvepn
yvi h akshgia grq l r nl     
maa    aaf a  a m            
© 1998-2020Legal notice