Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G1G0_HRK-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVVFQGLGVGLRSGE
                                                                          

F7G1G0_HRK-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          CAPRLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSA
                                                                          

F7G1G0_HRK-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       ------------------------MEPPHYVEELEDDVFHPEDSEPGAQP
A0A5F8H037_BCL2L11      -------------MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPT
A0A5F8H037_BCL2L11      -------------MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPT
A0A5F8GA49_BAD-01       ----------MTVSLTQATGAGLPPKQERG---------GGGGESPGAEH
F7GL32_BBC3-02          --------------MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVS
F7GL32_BBC3-01          HLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVS
                                                                          

F7G1G0_HRK-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       GGLTSAALFAQS-----------------QPDYMLDGLQLFPLTHCCGPG
A0A5F8H037_BCL2L11      SIQTQY--------------------------------------------
A0A5F8H037_BCL2L11      SIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLL
A0A5F8GA49_BAD-01       RDLAAA---PRESETPS------------WPDDASRPVSMFQIPEF----
F7GL32_BBC3-02          CSLCEAGLNPSGDSMCP------------APGPALAPSSLLPLAYFCTRQ
F7GL32_BBC3-01          CSLCEAGLNPSGDSMCP------------APGPALAPSSLLPLAYFCTRQ
                                                                          

F7G1G0_HRK-01           -------------MCPCPLHRGRGPPAVCACSSDRLEQRAAAAA------
A0A5F8GKJ8_BMF-01       LRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAG------YR
A0A5F8H037_BCL2L11      -----------QDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------AS
A0A5F8H037_BCL2L11      PRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDH-AS
A0A5F8GA49_BAD-01       -----EPGEQEDGSERAPGQPGGPGRRSSAAPGAQRHEGAGDRRPRLISY
F7GL32_BBC3-02          PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQ--GA
F7GL32_BBC3-01          PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQ--GA
                                        ..   .                            

F7G1G0_HRK-01           ---------------------------------------------QLTAA
A0A5F8GKJ8_BMF-01       LPLPASFPASLRLGEEPPEEQWEHRAE------------------VQIAQ
A0A5F8H037_BCL2L11      MRQSQSIPADMRPE-------------------------------IWIAQ
A0A5F8H037_BCL2L11      MRQSQSIPADMRPE-------------------------------IWIAQ
A0A5F8GA49_BAD-01       PPLREGPAVEVGPEAGAQAERAEAEEDRGLFRSRSSSAPPILWAARRYGS
F7GL32_BBC3-02          SPMSGGPPGVLGPEHGDQGEQQD----------------------REIGA
F7GL32_BBC3-01          SPMSGGPPGVLGPEHGDQGEQQD----------------------REIGA
                                                                        . 

F7G1G0_HRK-01           RLKALGDELQERTM-WRRRARSRRAAAEAAGSGGGGLPAYWAWLCAAAHV
A0A5F8GKJ8_BMF-01       KLQCIADQFHRLHM---------------QRHQQNRNHVWWQILLFLHN-
A0A5F8H037_BCL2L11      ELRRIGDEFNASYY---------------------PRRAVWHCFKSFGIG
A0A5F8H037_BCL2L11      ELRRIGDEFNASYY-----PRRGFLDNNYQGAGDHHQMVILRLLRYIIRL
A0A5F8GA49_BAD-01       ELRRMSDEFDCSFKGLPRPKSAGTASQMRRSHGWTRTVQSW-FGRNLGKG
F7GL32_BBC3-02          QLRRMADDLNALYE------------QRRREEEQRRHLSPWRLLYNLISG
F7GL32_BBC3-01          QLRRMADDLNALYE------------QRRREEEQRRHLSPWRLLYNLISG
                         *. :.*::                                         

F7G1G0_HRK-01           AALAAWLLRRRNL---
A0A5F8GKJ8_BMF-01       -LALNREENRNGAGPR
A0A5F8H037_BCL2L11      VGSQL-----------
A0A5F8H037_BCL2L11      VWRMQ-----------
A0A5F8GA49_BAD-01       GAGPSH----------
F7GL32_BBC3-02          LLAPQRRNRMPDVEPN
F7GL32_BBC3-01          LLAPQRRNRMPDVEPN
                                        

© 1998-2022Legal notice