Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G1G0_HRK-01          --------------------------------------------------
F7CXT2_BCL2L11-01      MAKQPSDL------------------------------------------
F7CXT2_BCL2L11-02      MAKQPSDL------------------------------------------
F7GL32_BBC3-02         --------------------------------------------------
F7GL32_BBC3-01         MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVVFQGLGVGLRSGE
                                                                         

F7G1G0_HRK-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
F7CXT2_BCL2L11-02      --------------------------------------------------
F7GL32_BBC3-02         --------------------------------------------------
F7GL32_BBC3-01         CAPRLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSA
                                                                         

F7G1G0_HRK-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------NSECDREGGQLQPTE-------RPTQPQQLRPGAPT
F7CXT2_BCL2L11-02      --------------NSECDREGGQLQPTE-------RPTQPQQLRPGAPT
F7GL32_BBC3-02         --------------MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVS
F7GL32_BBC3-01         HLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVS
                                                                         

F7G1G0_HRK-01          ---------------MCPCP------------------------------
F7CXT2_BCL2L11-01      SIQTQ---------------------------------------------
F7CXT2_BCL2L11-02      SIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLL
F7GL32_BBC3-02         CSLCE-AGLNPSGDSMCPAP--GPALAPSSLLPLA---------------
F7GL32_BBC3-01         CSLCE-AGLNPSGDSMCPAP--GPALAPSSLLPLA---------------
                                                                         

F7G1G0_HRK-01          ------LHRGRGPPAVCACSSDRLEQRAAAAAQLTAARLKALGD------
F7CXT2_BCL2L11-01      ------Y----QDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASM
F7CXT2_BCL2L11-02      PRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASM
F7GL32_BBC3-02         ------YFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEE
F7GL32_BBC3-01         ------YFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEE
                                     :       .  . .:.  *     * ::        

F7G1G0_HRK-01          --------------------------------ELQERTMWRRRARSRRAA
F7CXT2_BCL2L11-01      RQSQSIPADMRP--------------------EIWIAQELRRIGDEFNAS
F7CXT2_BCL2L11-02      RQSQSIPADMRP--------------------EIWIAQELRRIGDEFNAS
F7GL32_BBC3-02         GGQEGEPQGASPMSGGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNAL
F7GL32_BBC3-01         GGQEGEPQGASPMSGGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNAL
                                                       :       ** . . .* 

F7G1G0_HRK-01          AEAAG-------SGGGGLPAYWAWLCAAAHVAALAAWLLRRRNL-----
F7CXT2_BCL2L11-01      YYPRR----------------AVWHCFKSFGIGVGSQL-----------
F7CXT2_BCL2L11-02      YYPRRGFLDNNYQGAGDHHQMVILRLLRYIIRLVWRMQ-----------
F7GL32_BBC3-02         YEQRR-------REEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
F7GL32_BBC3-01         YEQRR-------REEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
                                                        :               

© 1998-2020Legal notice