Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G1G0_HRK-01           --------------------------------------------------
F7GL32_BBC3-01          MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVVFQGLGVGLRSGE
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
                                                                          

F7G1G0_HRK-01           --------------------------------------------------
F7GL32_BBC3-01          CAPRLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSA
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
                                                                          

F7G1G0_HRK-01           ---------------------------------MCPCPLHRGRGPPAVCA
F7GL32_BBC3-01          HLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVS
A0A5F8GKJ8_BMF-01       ---------------MEPPHYVEELEDDVFHPEDSEPGAQPGGLTSAALF
A0A5F8H037_BCL2L11      -------------MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPT
A0A5F8H037_BCL2L11      -------------MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPT
A0A5F8GA49_BAD-01       ------------MTVSLTQATGA------GLPPKQERG-GGGGESPGAEH
F7GL32_BBC3-02          --------------MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVS
                                                                     ...  

F7G1G0_HRK-01           C-------------------------------------------------
F7GL32_BBC3-01          C------------SLCEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQ
A0A5F8GKJ8_BMF-01       A--------------------------QSQPDYMLDGLQLFPLTHCCGPG
A0A5F8H037_BCL2L11      SIQTQYQ-------------------------------------------
A0A5F8H037_BCL2L11      SIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLL
A0A5F8GA49_BAD-01       R------------DLAAA---PRESETPSWPDDASRPVSMFQIPEF----
F7GL32_BBC3-02          C------------SLCEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQ
                                                                          

F7G1G0_HRK-01           ------------------------------------------------SS
F7GL32_BBC3-01          PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQ--GA
A0A5F8GKJ8_BMF-01       LRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAG------YR
A0A5F8H037_BCL2L11      ------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------AS
A0A5F8H037_BCL2L11      PRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDH-AS
A0A5F8GA49_BAD-01       -----EPGEQEDGSERAPGQPGGPGRRSSAAPGAQRHEGAGDRRPRLISY
F7GL32_BBC3-02          PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQ--GA
                                                                          

F7G1G0_HRK-01           DRLEQRAAAAA----------------------------------QLTAA
F7GL32_BBC3-01          SPMSGGPPGVLGPEHGDQGEQQD----------------------REIGA
A0A5F8GKJ8_BMF-01       LPLPASFPASLRLGEEPPEEQWEHRAE------------------VQIAQ
A0A5F8H037_BCL2L11      MRQSQSIPADMRPE-------------------------------IWIAQ
A0A5F8H037_BCL2L11      MRQSQSIPADMRPE-------------------------------IWIAQ
A0A5F8GA49_BAD-01       PPLREGPAVEVGPEAGAQAERAEAEEDRGLFRSRSSSAPPILWAARRYGS
F7GL32_BBC3-02          SPMSGGPPGVLGPEHGDQGEQQD----------------------REIGA
                               .                                        . 

F7G1G0_HRK-01           RLKALGDELQERTM-WRRRARSRRAAAEAAGSGGGGLPAYWAWLCAAAHV
F7GL32_BBC3-01          QLRRMADDLNALYE------------QRRREEEQRRHLSPWRLLYNLISG
A0A5F8GKJ8_BMF-01       KLQCIADQFHRLHM------------QRHQQNRNHVWWQILLFLHNLALN
A0A5F8H037_BCL2L11      ELRRIGDEFNASYY--PRR-------------------AVWHCFKSFGIG
A0A5F8H037_BCL2L11      ELRRIGDEFNASYY--PRRGFLDNNYQGAGDHHQMVILRLLRYIIRLVWR
A0A5F8GA49_BAD-01       ELRRMSDEFDCSFKGLPRPKSAGTASQMRRSHGWTRTVQSW-FGRNLGKG
F7GL32_BBC3-02          QLRRMADDLNALYE------------QRRREEEQRRHLSPWRLLYNLISG
                         *. :.*::                                         

F7G1G0_HRK-01           AALAAWLLRRRNL---
F7GL32_BBC3-01          LLAPQRRNRMPDVEPN
A0A5F8GKJ8_BMF-01       REENRNGAGPR-----
A0A5F8H037_BCL2L11      VGSQL-----------
A0A5F8H037_BCL2L11      MQ--------------
A0A5F8GA49_BAD-01       GAGPSH----------
F7GL32_BBC3-02          LLAPQRRNRMPDVEPN
                                        

© 1998-2022Legal notice