Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A5F8GA49_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Monodelphis domestica GN=BAD (length=212 residues).
MTVSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESETPSWPDDASRPVSMFQIPEFEPGEQEDGSERAPGQPGG
PGRRSSAAPGAQRHEGAGDRRPRLISYPPLREGPAVEVGPEAGAQAERAEAEEDRGLFRSRSSSAPPILWAARRYGSELR
RMSDEFDCSFKGLPRPKSAGTASQMRRSHGWTRTVQSWFGRNLGKGGAGPSH
>gnl|bcl2dbpro|A0A5F8GKJ8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Monodelphis domestica GN=BMF (length=184 residues).
MEPPHYVEELEDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPASFPASLRLGEEPPEEQWEHRAEVQIAQKLQCIADQFHRLHMQRHQQNRNHVW
WQILLFLHNLALNREENRNGAGPR
>gnl|bcl2dbpro|A0A5F8H037_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L11 (length=129 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQS
QSIPADMRPEIWIAQELRRIGDEFNASYYPRRAVWHCFKSFGIGVGSQL
>gnl|bcl2dbpro|A0A5F8H037_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L11 (length=205 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIF
LRRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASMRQSQSIPADMRPEIWIAQELRRI
GDEFNASYYPRRGFLDNNYQGAGDHHQMVILRLLRYIIRLVWRMQ
>gnl|bcl2dbpro|F7G1G0_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Monodelphis domestica GN=HRK (length=98 residues).
MCPCPLHRGRGPPAVCACSSDRLEQRAAAAAQLTAARLKALGDELQERTMWRRRARSRRAAAEAAGSGGGGLPAYWAWLC
AAAHVAALAAWLLRRRNL
>gnl|bcl2dbpro|F7GL32_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Monodelphis domestica GN=BBC3 (length=318 residues).
MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVVFQGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRCECGAG
LGKLRRGRARGVAPPLTCSAHLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNP
SGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQGASPMS
GGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
>gnl|bcl2dbpro|F7GL32_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Monodelphis domestica GN=BBC3 (length=204 residues).
MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGG
PRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQGASPMSGGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLN
ALYEQRRREEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
© 1998-2022Legal notice