Dataset for protein classical BH3-containing proteins of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------makqpsdvg----secdqeggqlqpverppqlrpga------------------
mkfgvgsaracpcqaprasfsrmvvk---e--q--rgppe-ledd--v--------------vlsadlfaqsqldcplsr
                      cpsivrm-na-cv    -p----rq-fgledgesgtqlasr vpsavspglmkpgvrs
                       mqgpirsmterr    mvvspseplpdarrsggrrtasp   lp rpc acgfv pp
                       fpekepk rrqh    qsstspakre  ssdaappi lv            e   ga
                          hcfg lhlf    gdrkkg hna  a      g er                  
                             c   ae    d gfcf             f  g                  
                                       a aaaa                                   
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----ptslqtepqgrp-----tg-re-egdrcp-gspqgplapp-------trspl--f---------------------
lqlfllthpcg-gpncrrlple-s--g------h----------aspgpfa-----fl-vrrslplvyrqrvpwsllsrs
ararssrtcrry-la-     -sqedkatqtlspawqsqgvmlqcgrr vvpeesqriaygnaaagsadpqrgggvggsl
 p c aqmrdass--t     vappavtravsgvrpflswrsrlrlas rggqprgstmeqhl            p    
   a kpcga qrtsr     sthtsrsehlrlrqm ghss hhpa   dpa l amalhspg                 
     glaep llsqa     rpelpfra aghqlg paig d g    al     l  aal                  
     ci    ihqh      c c  dl   a g a i fe         e                             
      d    afkg        a  a            d                                        
      a     eee                                                                 
            dc                                                                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------rspapmscdkstqtpsppcpafnhylsam-------------------------elrrigdef
ssgyfsfdtdvarfwrs------pagppag---g-qqgv---e-rwasqrqfqaepadmrpeiwiaqqiqq-------ql
hp gptsrwng      gyrvrsvp-----lgt-ear--rsw-h--evmiarklqciadqshrlhvrehgaqqnpmaw--
 d faglagg       epvl la-sflqagelqa--velqeqeqavretppvvvttsvpfqtgtparyvrp snvwadi
                 slsy w-wrafprddgtss tqggtywprraa egrgrsrpfd nlfa  pt ln   ltgkv
                 lals vmrlrrl s rrmr rmprstvlnlc   epflegea   h       g    ds gs
                 h kr pgmeqde m ie g elcll teli     l                         f 
                    g gd  ea  e ed e  i af r g      i                           
                    f a         aa    a  a q                                    
                                                                                

       250       260       270       280         
....:....|....:....|....:....|....:....|....:....
                                                 
nayysrr--l---------------------------------------
----k--vl-nnyqrngsppqmvilrllhyivrliwrrhpemepnapsq
llql-nlrferrqradedhwrvlyslimgllplprgh avgrggs    
hslthwvlqnpqlnsrptgtdtrqntswtrvtqsw d n          
qffqephavrglephtraa  i a sgdsfcim                
gdsfrlgqpkeevkqslg                               
e raak ngidsshci                                 
a c  f magvkpg e                                 
       d    gf a                                 
            d                                    
© 1998-2023Legal notice