Dataset for protein classical BH3-containing proteins of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------akqpsdvgsecdqe---------g-qlqpverppqlrpga-----
msevrpsptdlfmdafpfehlldplilevlsimmm--------------rvslsrpfp-g--------sgtqqpsvlsad
                              mfqiremeggqcvepleddqrdgrlcvilhvfmledger--a--g     
                                 epfrve sspcsvsapaaafp a   drrv rkks-kn-rsp     
                                 ak qd  predlsqsl           img slvagrrtkl-     
                                  d g   eqa  e g            e d  a hcp mef      
                                    f   a                              g        
                                                                       c        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------ptslqtepqgnpegsregeg------sp-g----p-spgp---r-------------------
lfaqsqldcplsrlqlfglthrag-gl----q---atdrcphg--q-plap-a----fpt-splfifvrrssllsrsssg
                p-grtcc-t--rats-edk--qtlsparssqgvmlrcgvteeaqplr pvrpslpdrrhtrrgn
                 v--applgsrlsctapsrpvapsvvtgqlsssswhgparsrtaar   llgh  agfa lpc 
                 spd---c rqt yaylrpwrplphqqcaprrrrh shraqve                     
                 lmarhsa lmp rpphvfr  agccla a appa   i  l                      
                  a mg   ckh pllfcal   aa        g                              
                         aac ad a  c                                            
                           a                                                    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------rspapmscdkstqtpsppcqafnhylsam---r-fqa-----------a-----elrrigdefna-y-rr---
yfsfdtd--------p--l---eq--e---------asm-q---epadmrpeiwi-qeiga-----a--lh-y-s--vfl
vygnwgyllsylagp-pg-sla--hl-sqwrsargvqiggpgvvasgvrpeseqwtrryvrqdqcm-gq--srtkwllre
fprqarspqfrawvfqarspvggldapgpvqhrpealaeirttrvhrstggnlsqggav pk knltadsqqqqelhrqv
pgmalqrhg l rpaegdrvmldgastvlppveastvra gqrqs pggt fd gef c lr  gps kdglspqkgqpa
 al   f a s pfe ecegfeae irtgrlmcvrrrqn eepgr  ea   a a e    p  a   g egllmfanlr
            la      a  d g  algl  pqep    iff                g      f  f f   mhk
            d            e     f  ll e    g                         a  d      ai
                                                                                
                                                                                

       250       260       270       280       290       300       310  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
                                                                        
------------------------------------------------------------------------
nqyqanedhpqmvillllhylvlliwrrhpgmgprnpsqgactrpvdvgdlggrtlsppdtlastgdsfctm
rnsrqdqsrwwwqynrimgniarprghnaneaernglql                                 
qsqphrpnpvrvlqwsfwtlvpqngeetrwprsgsaa                                   
pkhhgtatttpstlspwvqshigvwapaqvlq  d                                     
ervfssgpgallr egs crah tp l ng l                                        
vltarp ea  ia   p  a   sa d                                             
dep ci                                                                  
a l  a                                                                  
  d                                                                     
© 1998-2022Legal notice