Dataset for protein classical BH3-containing proteins of organism Microcebus murinus

[Download (right click)] [Alignment] [Repertoires]

18 sequence(s)

>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYSRRVFLNNYQADEDHPQMVILRLLHYIVRLIWRRH
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=135 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=174 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYSRRMPLPSD
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=87 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYSRRLA
KRLVPSI
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYSRRVFLNNYQADEDHPQMVILRLLHYIVRLIWRRH
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAE
PADMRPEIWIAQELRRIGDEFNAYYSRRVFLNNYQADEDHPQMVILRLLHYIVRLIWRRH
>gnl|bcl2dbpro|A0A8B7FTF7_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Microcebus murinus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSPRAPAPGALSTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8B7G497_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Microcebus murinus GN=BBC3 (length=131 residues).
MKFGVGSARACPCQAPRASFSRCVPGHIRGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A8B7G497_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Microcebus murinus GN=BBC3 (length=260 residues).
MKFGVGSARACPCQAPRASFSRCVPGHIRGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGCVLRPLRARPAR
CPRRPRPAPRRLPLRPHRPARRHRRPGGPPLAWGSPQPAPRPAPGRSSALALAGRAAPGVARPQRPGGPGGRSHPGGPGS
AWGGGAVGPGDRGPAAADGGRPQRAVRAAETRGAAETPPLALEGPVQSHHGTPAPTQGPQSPDGAQLGACTRPVDVGDLG
GRTLSPPDTLASTGDSFCTM
>gnl|bcl2dbpro|A0A8B7G497_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Microcebus murinus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A8B7HMR3_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Microcebus murinus GN=PMAIP1 (length=117 residues).
MPVKKARKNAQPSPTRTRAGTGRTAETAREGARCGVGMQLQFLAPSLLFPPPCLPFPGDDITSGRRMCSSTQENRRQTAF
PAETTEFDSQTFPLRNLTDFSQSRYKFHQLEDRSHCN
>gnl|bcl2dbpro|A0A8B7HMR3_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Microcebus murinus GN=PMAIP1 (length=54 residues).
MPVKKARKNAQPSPTRTRAEIEEECVLQLRRIGDKLHFQQKLLNLIVKLFRSGT
>gnl|bcl2dbpro|A0A8C5UXV9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Microcebus murinus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A8C5UXV9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Microcebus murinus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A8C5UXV9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Microcebus murinus GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPTQPRFERRREQERGGPQ
>gnl|bcl2dbpro|A0A8C5VCL0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Microcebus murinus GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSADRGLGPSPSGDLPPGPSKHPCTAPSFLGDASHQQGQPSSSSHHGGAGPVETRSRHSSYPAGA
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKGLPRPKSAGTATQIRQSSSWTRVIQSWWDRNVG
RGGSAPSQ
>gnl|bcl2dbpro|A0A8C5YCP8_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Microcebus murinus GN=BIK (length=150 residues).
MSEVRPSPTDLFMDAFPFEHLLDPLILEVLSIMEDEQDPSPSGCLEDSEQVALRLAFIGDEMDLRLRSPRLARLPGMTMH
SLGLALSYDQRVGWGVLGSLSDGFATLRGNVARFWRSLSPRPWVCPGGPEQVLLLLLVLLLGGGLHLLLK
© 1998-2022Legal notice