Dataset for protein classical BH3-containing proteins of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B7HMR3_PMAIP1-      --------------------------------------------------
A0A8B7G497_BBC3-03      ---------------------------------MKFGVGSARACPCQAPR
A0A8B7HMR3_PMAIP1-      --------------------------------------------------
A0A8B7FTF7_HRK-01       --------------------------------------------------
A0A8B7G497_BBC3-02      --------------------------------------------------
A0A8B7G497_BBC3-01      --------------------------------MARARQEGSSPEPVEGLA
A0A8C5UXV9_BMF-03       ------------------------------------MEPSQCVEELEDD-
A0A8C5UXV9_BMF-01       ------------------------------------MEPSQCVEELEDD-
A0A8C5UXV9_BMF-02       ------------------------------------MEPSQCVEELEDD-
A0A8C5VCL0_BAD-01       ------------------------------MFQIPEFEPSEQEDSSSAD-
A0A8C5YCP8_BIK-01       MSEVRPSPTDLFMDAFPFEHLLDPLILEVLSIMEDEQDPSPSGCLEDSEQ
A0A8B7EUP7_BCL2L11      ----------------------------------MAKQPSDVGSECDQE-
A0A8B7EUP7_BCL2L11      ----------------------------------MAKQPSDVGSECDQE-
A0A8B7EUP7_BCL2L11      ----------------------------------MAKQPSDVGSECDQE-
A0A8B7EUP7_BCL2L11      ----------------------------------MAKQPSDVGSECDQE-
A0A8B7EUP7_BCL2L11      ----------------------------------MAKQPSDVGSECDQE-
A0A8B7EUP7_BCL2L11      ----------------------------------MAKQPSDVGSECDQE-
A0A8B7EUP7_BCL2L11      ----------------------------------MAKQPSDVGSECDQE-
                                                                          

A0A8B7HMR3_PMAIP1-      ------------MPVKKARKNAQPS----------------------PTR
A0A8B7G497_BBC3-03      ASFSRCVPGHIRGPRERHGPRTPGG-------------------QLPGAR
A0A8B7HMR3_PMAIP1-      ------------MPVKKARKNAQPS----------------------PTR
A0A8B7FTF7_HRK-01       --------------------------------------------------
A0A8B7G497_BBC3-02      ---------------------MKFG----------------------VGS
A0A8B7G497_BBC3-01      RDGPRPFPLGRLVPSAVSCGLCEPG----------------------LPA
A0A8C5UXV9_BMF-03       ----------VFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLT
A0A8C5UXV9_BMF-01       ----------VFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLT
A0A8C5UXV9_BMF-02       ----------VFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLT
A0A8C5VCL0_BAD-01       ------------------RGLGPSP----------------------SGD
A0A8C5YCP8_BIK-01       VALRLAFIGDEMDLRLRSPRLARLP----------------------GMT
A0A8B7EUP7_BCL2L11      --------GGQLQPVERPPQLRPGA----------------------PTS
A0A8B7EUP7_BCL2L11      --------GGQLQPVERPPQLRPGA----------------------PTS
A0A8B7EUP7_BCL2L11      --------GGQLQPVERPPQLRPGA----------------------PTS
A0A8B7EUP7_BCL2L11      --------GGQLQPVERPPQLRPGA----------------------PTS
A0A8B7EUP7_BCL2L11      --------GGQLQPVERPPQLRPGA----------------------PTS
A0A8B7EUP7_BCL2L11      --------GGQLQPVERPPQLRPGA----------------------PTS
A0A8B7EUP7_BCL2L11      --------GGQLQPVERPPQLRPGA----------------------PTS
                                                                          

A0A8B7HMR3_PMAIP1-      TRAE----------------------------------------------
A0A8B7G497_BBC3-03      RGPGPRRPAPLPARPPGALGCVLRPLRARPARCPRRPRPAPRRLPLRPHR
A0A8B7HMR3_PMAIP1-      TRAGTGRTAETAREGAR---------------------------------
A0A8B7FTF7_HRK-01       ------MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAA---------
A0A8B7G497_BBC3-02      ARACPCQAPRASFSRCV--------------PGHIR--------------
A0A8B7G497_BBC3-01      APAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRP-----------
A0A8C5UXV9_BMF-03       HCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRL--------
A0A8C5UXV9_BMF-01       HCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRL--------
A0A8C5UXV9_BMF-02       HCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRL--------
A0A8C5VCL0_BAD-01       LPPGPSKHPCTAPSFLGDASHQQGQPSSSSHHGGAGPVETRS--------
A0A8C5YCP8_BIK-01       MHSLGLALSYDQRVGWG----------------------------VLGSL
A0A8B7EUP7_BCL2L11      LQTEPQ--------------------------------------------
A0A8B7EUP7_BCL2L11      LQTEPQ--------------------------------------------
A0A8B7EUP7_BCL2L11      LQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A8B7EUP7_BCL2L11      LQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A8B7EUP7_BCL2L11      LQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A8B7EUP7_BCL2L11      LQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A8B7EUP7_BCL2L11      LQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRR
                                                                          

A0A8B7HMR3_PMAIP1-      --------------------------------------------------
A0A8B7G497_BBC3-03      PARRHRRPGGPPLAWGSPQPAPRPAPGRSSALALAGRAAPGVARPQRPGG
A0A8B7HMR3_PMAIP1-      --------CGVGMQLQFLAPSLLFPPPCLPFPGDDITSGRRMCSSTQENR
A0A8B7FTF7_HRK-01       --------------------------------------------------
A0A8B7G497_BBC3-02      -----------------------GPQPSLSLAEQHLESPVPSAPGALAGG
A0A8B7G497_BBC3-01      -----------------RGPRPDGPQPSLSLAEQHLESPVPSAPGALAGG
A0A8C5UXV9_BMF-03       -------------------FYAPAEPKSRVVADPPLPTQPRFERRREQER
A0A8C5UXV9_BMF-01       ----------FYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIAR
A0A8C5UXV9_BMF-02       ----------FYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIAR
A0A8C5VCL0_BAD-01       ----------------RHSSYPAGAEEDEGMEEEPSP-------------
A0A8C5YCP8_BIK-01       SDGFATLRGNVARFWRSLSPRPWVC------PGGPEQVLLLLLVLL----
A0A8B7EUP7_BCL2L11      ----------------------------------------------ASMR
A0A8B7EUP7_BCL2L11      ----------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8B7EUP7_BCL2L11      SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM----
A0A8B7EUP7_BCL2L11      SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREI
A0A8B7EUP7_BCL2L11      SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8B7EUP7_BCL2L11      SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A8B7EUP7_BCL2L11      SSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
                                                                          

A0A8B7HMR3_PMAIP1-      --------------IEEECVLQLRRIGDKLHFQQKLLNLIVKLFRSGT--
A0A8B7G497_BBC3-03      PGGRSHPGGPGSAWGGGAVGPGDRGPAAADGGRPQRAVRAAETRGAAETP
A0A8B7HMR3_PMAIP1-      RQTAFPAETTEFDSQTF----PLRNLTDFSQSRYKFHQLEDRSHCN----
A0A8B7FTF7_HRK-01       ---------------------RLKALGDELHQRTMWRRRARSPRAPAPGA
A0A8B7G497_BBC3-02      PTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPW
A0A8B7G497_BBC3-01      PTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPW
A0A8C5UXV9_BMF-03       GGPQ----------------------------------------------
A0A8C5UXV9_BMF-01       ---------------------KLQCIADQFH-----RLHVQQHQQNQNRV
A0A8C5UXV9_BMF-02       ---------------------KLQCIADQFH-----RLHVQQHQQNQNRV
A0A8C5VCL0_BAD-01       -FRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKGLPRPKSAGT--AT
A0A8C5YCP8_BIK-01       -------------------------LGGGLHLLLK---------------
A0A8B7EUP7_BCL2L11      QFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRLAKRLVPSI----
A0A8B7EUP7_BCL2L11      QFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRVFLNNYQADEDHP
A0A8B7EUP7_BCL2L11      -GIFE---------------------------------------------
A0A8B7EUP7_BCL2L11      EEVVV---------------------------------------------
A0A8B7EUP7_BCL2L11      QFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRMPLPSD-------
A0A8B7EUP7_BCL2L11      QFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRVFLNNYQADEDHP
A0A8B7EUP7_BCL2L11      QFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRVFLNNYQADEDHP
                                                                          

A0A8B7HMR3_PMAIP1-      --------------------------------------------------
A0A8B7G497_BBC3-03      PLALEGPVQSHHGTPAPTQGPQSPDGAQLGACTRPVDVGDLGGRTLSPPD
A0A8B7HMR3_PMAIP1-      --------------------------------------------------
A0A8B7FTF7_HRK-01       LSTYWPWLCAAAQVAALAAWLLGRRNL-----------------------
A0A8B7G497_BBC3-02      RVLYNLIMGLLPLPRGHRAPEMEPN-------------------------
A0A8B7G497_BBC3-01      RVLYNLIMGLLPLPRGHRAPEMEPN-------------------------
A0A8C5UXV9_BMF-03       --------------------------------------------------
A0A8C5UXV9_BMF-01       WWQILLFLHNLALNGEENRNGAGPR-------------------------
A0A8C5UXV9_BMF-02       WWQILLFLHNLALNGEENRNGAGPR-------------------------
A0A8C5VCL0_BAD-01       QIRQSSSWTRVIQSWWDRNVGRGGSAPSQ---------------------
A0A8C5YCP8_BIK-01       --------------------------------------------------
A0A8B7EUP7_BCL2L11      --------------------------------------------------
A0A8B7EUP7_BCL2L11      QMVILRLLHYIVRLIWRRH-------------------------------
A0A8B7EUP7_BCL2L11      --------------------------------------------------
A0A8B7EUP7_BCL2L11      --------------------------------------------------
A0A8B7EUP7_BCL2L11      --------------------------------------------------
A0A8B7EUP7_BCL2L11      QMVILRLLHYIVRLIWRRH-------------------------------
A0A8B7EUP7_BCL2L11      QMVILRLLHYIVRLIWRRH-------------------------------
                                                                          

A0A8B7HMR3_PMAIP1-      ------------
A0A8B7G497_BBC3-03      TLASTGDSFCTM
A0A8B7HMR3_PMAIP1-      ------------
A0A8B7FTF7_HRK-01       ------------
A0A8B7G497_BBC3-02      ------------
A0A8B7G497_BBC3-01      ------------
A0A8C5UXV9_BMF-03       ------------
A0A8C5UXV9_BMF-01       ------------
A0A8C5UXV9_BMF-02       ------------
A0A8C5VCL0_BAD-01       ------------
A0A8C5YCP8_BIK-01       ------------
A0A8B7EUP7_BCL2L11      ------------
A0A8B7EUP7_BCL2L11      ------------
A0A8B7EUP7_BCL2L11      ------------
A0A8B7EUP7_BCL2L11      ------------
A0A8B7EUP7_BCL2L11      ------------
A0A8B7EUP7_BCL2L11      ------------
A0A8B7EUP7_BCL2L11      ------------
                                    

© 1998-2022Legal notice