Dataset for protein classical BH3-containing proteins of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B7HMR3_PMAIP1-      ---------------------------------------MPVKKARKNAQ
A0A8B7EUP7_BCL2L11      --------------------------MAKQPSDVG----SECDQEGGQLQ
A0A8B7FTF7_HRK-01       --------------------------MCPCPLHRGRGPPAVCACSAGRLG
A0A8B7G497_BBC3-03      MKFGVGSARACPCQAPRASFSRCVPGHIRGPRERH----GPRTPGGQLPG
A0A8B7HMR3_PMAIP1-      ----------------------MPVKKARKNAQ-----------------
A0A8B7G497_BBC3-02      --------------------------------------------------
A0A8B7G497_BBC3-01      ------------------------------MARAR----QEGSSPEPVEG
A0A8C5UXV9_BMF-03       ----------------------------MEPSQCV----EELEDD--VFQ
A0A8C5UXV9_BMF-02       ----------------------------MEPSQCV----EELEDD--VFQ
A0A8C5UXV9_BMF-01       ----------------------------MEPSQCV----EELEDD--VFQ
A0A8C5VCL0_BAD-01       ----------------------MFQIPEFEPSEQE----DSSSADRG---
A0A8C5YCP8_BIK-01       -----------------------MSEVRPSPTDLF----MDAFPFEHLLD
A0A8B7EUP7_BCL2L11      --------------------------MAKQPSDVG----SECDQEGGQLQ
A0A8B7EUP7_BCL2L11      --------------------------MAKQPSDVG----SECDQEGGQLQ
A0A8B7EUP7_BCL2L11      --------------------------MAKQPSDVG----SECDQEGGQLQ
A0A8B7EUP7_BCL2L11      --------------------------MAKQPSDVG----SECDQEGGQLQ
A0A8B7EUP7_BCL2L11      --------------------------MAKQPSDVG----SECDQEGGQLQ
A0A8B7EUP7_BCL2L11      --------------------------MAKQPSDVG----SECDQEGGQLQ
                                                                          

A0A8B7HMR3_PMAIP1-      PS--------------------------------PTRTRAEIEEEC----
A0A8B7EUP7_BCL2L11      PVERPPQLRPGA----------------------PTSLQTE--PQA----
A0A8B7FTF7_HRK-01       LRSSAAQLTAAR----------------------LKALGDELHQRT----
A0A8B7G497_BBC3-03      ARRGPGPRRPAP---LPARPPGALGCVLRPLRARPARCPRRPRPAPRRLP
A0A8B7HMR3_PMAIP1-      ----------------------------------PSPTRTRAGTGR----
A0A8B7G497_BBC3-02      -----------------------MKFGVGSARACPCQAPRASFSRC----
A0A8B7G497_BBC3-01      LARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAP----
A0A8C5UXV9_BMF-03       PEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRP----
A0A8C5UXV9_BMF-02       PEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRP----
A0A8C5UXV9_BMF-01       PEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRP----
A0A8C5VCL0_BAD-01       -------LGPSP----------------------SGDLPPGPSKHP----
A0A8C5YCP8_BIK-01       P------LILEV----------------------LSIMEDEQDPSP----
A0A8B7EUP7_BCL2L11      PVERPPQLRPGA----------------------PTSLQTEPQGNP----
A0A8B7EUP7_BCL2L11      PVERPPQLRPGA----------------------PTSLQTEPQGNP----
A0A8B7EUP7_BCL2L11      PVERPPQLRPGA----------------------PTSLQTEPQ-------
A0A8B7EUP7_BCL2L11      PVERPPQLRPGA----------------------PTSLQTEPQGNP----
A0A8B7EUP7_BCL2L11      PVERPPQLRPGA----------------------PTSLQTEPQGNP----
A0A8B7EUP7_BCL2L11      PVERPPQLRPGA----------------------PTSLQTEPQGNP----
                                                                          

A0A8B7HMR3_PMAIP1-      --------------------------------------------------
A0A8B7EUP7_BCL2L11      --------------------------------------------------
A0A8B7FTF7_HRK-01       --------------------------------------------------
A0A8B7G497_BBC3-03      LRPHRPARRHRRPGGPPLAWGSPQPAPRPAPGRSSALALAGRAAPGVARP
A0A8B7HMR3_PMAIP1-      -TAETAREGARCGVGMQLQFLAP---------------------------
A0A8B7G497_BBC3-02      -V--------------PGHIR---------GPQPSLSLAEQHL-------
A0A8B7G497_BBC3-01      -TAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLAEQHL-------
A0A8C5UXV9_BMF-03       -TSQEDKATQTLSPASPSQGVMLPCG----VTEEPQRLFYAPA-------
A0A8C5UXV9_BMF-02       -TSQEDKATQTLSPASPSQGVMLPCG----VTEEPQRLFYGNA-------
A0A8C5UXV9_BMF-01       -TSQEDKATQTLSPASPSQGVMLPCG----VTEEPQRLFYGNA-------
A0A8C5VCL0_BAD-01       -CTAPSFLGDASHQQGQPSSSSHHGGAGPVETRSR---------------
A0A8C5YCP8_BIK-01       -SGCLEDSEQVALRLAFIGDEMDLRLRSPRLARLPGMTMHSLGLALSYDQ
A0A8B7EUP7_BCL2L11      -EGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS-------
A0A8B7EUP7_BCL2L11      -EGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS-------
A0A8B7EUP7_BCL2L11      --------------------------------------------------
A0A8B7EUP7_BCL2L11      -EGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS-------
A0A8B7EUP7_BCL2L11      -EGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS-------
A0A8B7EUP7_BCL2L11      -EGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS-------
                                                                          

A0A8B7HMR3_PMAIP1-      --------------------------------------------------
A0A8B7EUP7_BCL2L11      ---------------------------------SMRQFQAEPADMRPEI-
A0A8B7FTF7_HRK-01       ---------------------------------MWRRRARSPRAPAPGAL
A0A8B7G497_BBC3-03      QRPGGPGGRSHPGGPGSAWGG------GAVGPGDRGPAAADGGRPQRAVR
A0A8B7HMR3_PMAIP1-      ---------------------------SLLFPPPCLPFPGDDITSGRRMC
A0A8B7G497_BBC3-02      ---------------------------ESPVPSAPGALAGGPTQAAPGVR
A0A8B7G497_BBC3-01      ---------------------------ESPVPSAPGALAGGPTQAAPGVR
A0A8C5UXV9_BMF-03       ---------------------------EPKSRVVADPPL-------PTQP
A0A8C5UXV9_BMF-02       ---------------------------GYRLPLPASFPAGLPLGEQPAEG
A0A8C5UXV9_BMF-01       ---------------------------GYRLPLPASFPAGLPLGEQPAEG
A0A8C5VCL0_BAD-01       ---------------------------HSSYPAGAEEDEGMEEEPSP---
A0A8C5YCP8_BIK-01       RVGWGVLGSLSDGFATLRGNVARFWRSLSPRPWVC------PGGPEQVLL
A0A8B7EUP7_BCL2L11      ----SLLSRSSSGYFSFDTD-------RSPAPMSCDKSTQTPSPPCQAFN
A0A8B7EUP7_BCL2L11      ----SLLSRSSSGYFSFDTD-------RSPAPMSCDKSTQTPSPPCQAFN
A0A8B7EUP7_BCL2L11      -------------------D-------RSPAPMSCDKSTQTPSPPCQAFN
A0A8B7EUP7_BCL2L11      ----SLLSRSSSGYFSFDTD-------RSPAPMSCDKSTQTPSPPCQAFN
A0A8B7EUP7_BCL2L11      ----SLLSRSSSGYFSFDTD-------RSPAPMSCDKSTQTPSPPCQAFN
A0A8B7EUP7_BCL2L11      ----SLLSRSSSGYFSFDTD-------RSPAPMSCDKSTQTPSPPCQAFN
                                                                          

A0A8B7HMR3_PMAIP1-      -----------------------------VLQLRRIGDKLHFQQKLLNLI
A0A8B7EUP7_BCL2L11      -----WIAQ----------------------ELRRIGDEFNAYYSRRLAK
A0A8B7FTF7_HRK-01       STYWPWLCA---------------------------AAQVAALAAWLLGR
A0A8B7G497_BBC3-03      AAETRGAAETPPLALEGPVQSHHGTPAPTQGPQSPDGAQLGACTRPVDVG
A0A8B7HMR3_PMAIP1-      SSTQENRRQTAFPAETTEFDSQTF-------PLRNLTDFSQSRYKFHQLE
A0A8B7G497_BBC3-02      GEEEQW-------------------AREIGAQLRRMADDLNAQYERRRQE
A0A8B7G497_BBC3-01      GEEEQW-------------------AREIGAQLRRMADDLNAQYERRRQE
A0A8C5UXV9_BMF-03       RFERRRE-------------------------------------------
A0A8C5UXV9_BMF-02       QWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALN
A0A8C5UXV9_BMF-01       QWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALN
A0A8C5VCL0_BAD-01       -----------FRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKG--L
A0A8C5YCP8_BIK-01       LLLVLL-----------------------------LGGGLHLLLK-----
A0A8B7EUP7_BCL2L11      HYLSAMVREIEEVVV-----------------------------------
A0A8B7EUP7_BCL2L11      HYLSAM-----GIFE-----------------------------------
A0A8B7EUP7_BCL2L11      HYLSAMASMRQFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRVFL
A0A8B7EUP7_BCL2L11      HYLSAMASMRQFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRVFL
A0A8B7EUP7_BCL2L11      HYLSAMASMRQFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRVFL
A0A8B7EUP7_BCL2L11      HYLSAMASMRQFQAEPADMRPEIWIAQ----ELRRIGDEFNAYYSRRMPL
                                                                          

A0A8B7HMR3_PMAIP1-      VKLFRSGT-------------------------------
A0A8B7EUP7_BCL2L11      RLVPSI---------------------------------
A0A8B7FTF7_HRK-01       RNL------------------------------------
A0A8B7G497_BBC3-03      DLGGRTLSPPDTLASTGDSFCTM----------------
A0A8B7HMR3_PMAIP1-      DRSHCN---------------------------------
A0A8B7G497_BBC3-02      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN----
A0A8B7G497_BBC3-01      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN----
A0A8C5UXV9_BMF-03       ----QERGGPQ----------------------------
A0A8C5UXV9_BMF-02       GEENRNGAGPR----------------------------
A0A8C5UXV9_BMF-01       GEENRNGAGPR----------------------------
A0A8C5VCL0_BAD-01       PRPKSAGTATQIRQSSSWTRVIQSWWDRNVGRGGSAPSQ
A0A8C5YCP8_BIK-01       ---------------------------------------
A0A8B7EUP7_BCL2L11      ---------------------------------------
A0A8B7EUP7_BCL2L11      ---------------------------------------
A0A8B7EUP7_BCL2L11      NNYQADEDHPQMVILRLLHYIVRLIWRRH----------
A0A8B7EUP7_BCL2L11      NNYQADEDHPQMVILRLLHYIVRLIWRRH----------
A0A8B7EUP7_BCL2L11      NNYQADEDHPQMVILRLLHYIVRLIWRRH----------
A0A8B7EUP7_BCL2L11      PSD------------------------------------
                                                               

© 1998-2023Legal notice