Dataset for protein Puma of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *: :* *.*.  * * :.  .              ** 
---------------------------------------mkfGvgsArAcPcqaPrAsfsrcv--------------PGh
mararqegsspepveglardgprpfplgrlvpsavscglcep lpa p a all a ylcaptappavtaalggprw  g
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *          *  .*. * .    .  :*:*: .****.                                      *
iR-------p-gPqpsLslAeq----hlesPvPs-aPGALa--------------------------------------G
p srrrrpr-rt ggq pg rrgpgprrpa l arp    gcvlrplrarparcprrprpaprrlplrphrparrhrrp 
  gppeghg d                                                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**.                        .*****                *  . *.      * .    **. ..*   *
GPt------------------------qAAPGVr---------------GeeeqWarei---GaqlrrmADdlnaQyerR
  plawgspqpaprpapgrssalalagr     arpqrpggpggrshpg pgsa gggavgp drgpaa  ggrp rav 
                                                                                

       250       260       270       280       290       300       310        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
  * .    ..*       : * :   .*  **   *:                                        
rqEeqqrhrpsPwrvlynlimGllplprGhrAPemePn----------------------------------------
aa trgaaetp la-----le pvqshh tp  tqg qspdgaqlgactrpvdvgdlggrtlsppdtlastgdsfctm
                                                                              
© 1998-2022Legal notice