Dataset for protein Puma of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B7G497_BBC3-03      ---------------------------------------MKFGVGSARAC
A0A8B7G497_BBC3-02      ---------------------------------------MKFGVGSARAC
A0A8B7G497_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAA
                                                                : *: :* *.

A0A8B7G497_BBC3-03      PCQAPRASFSRCV--------------PGHIRGPRERHGPRTPGGQLPGA
A0A8B7G497_BBC3-02      PCQAPRASFSRCV--------------PGHIR---------GPQPSLSLA
A0A8B7G497_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
                        *.  * * :.  .              **  *          *  .*. *

A0A8B7G497_BBC3-03      RRGPGPRRPAPLPARPPGALGCVLRPLRARPARCPRRPRPAPRRLPLRPH
A0A8B7G497_BBC3-02      EQ----HLESPVPS-APGALA-----------------------------
A0A8B7G497_BBC3-01      EQ----HLESPVPS-APGALA-----------------------------
                         .    .  :*:*: .****.                             

A0A8B7G497_BBC3-03      RPARRHRRPGGPPLAWGSPQPAPRPAPGRSSALALAGRAAPGVARPQRPG
A0A8B7G497_BBC3-02      ---------GGPT------------------------QAAPGVR------
A0A8B7G497_BBC3-01      ---------GGPT------------------------QAAPGVR------
                                 ***.                        .*****       

A0A8B7G497_BBC3-03      GPGGRSHPGGPGSAWGGGAVGPGDRGPAAADGGRPQRAVRAAETRGAAET
A0A8B7G497_BBC3-02      ---------GEEEQWAREI---GAQLRRMADDLNAQYERRRQEEQQRHRP
A0A8B7G497_BBC3-01      ---------GEEEQWAREI---GAQLRRMADDLNAQYERRRQEEQQRHRP
                                 *  . *.      * .    **. ..*   *  * .    .

A0A8B7G497_BBC3-03      PPLA-----LEGPVQSHHGTPAPTQGPQSPDGAQLGACTRPVDVGDLGGR
A0A8B7G497_BBC3-02      SPWRVLYNLIMGLLPLPRGHRAPEMEPN----------------------
A0A8B7G497_BBC3-01      SPWRVLYNLIMGLLPLPRGHRAPEMEPN----------------------
                        .*       : * :   .*  **   *:                      

A0A8B7G497_BBC3-03      TLSPPDTLASTGDSFCTM
A0A8B7G497_BBC3-02      ------------------
A0A8B7G497_BBC3-01      ------------------
                                          

© 1998-2022Legal notice