Dataset for protein Puma of organism Microcebus murinus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B7G497_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Microcebus murinus GN=BBC3 (length=131 residues).
MKFGVGSARACPCQAPRASFSRCVPGHIRGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A8B7G497_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Microcebus murinus GN=BBC3 (length=260 residues).
MKFGVGSARACPCQAPRASFSRCVPGHIRGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGCVLRPLRARPAR
CPRRPRPAPRRLPLRPHRPARRHRRPGGPPLAWGSPQPAPRPAPGRSSALALAGRAAPGVARPQRPGGPGGRSHPGGPGS
AWGGGAVGPGDRGPAAADGGRPQRAVRAAETRGAAETPPLALEGPVQSHHGTPAPTQGPQSPDGAQLGACTRPVDVGDLG
GRTLSPPDTLASTGDSFCTM
>gnl|bcl2dbpro|A0A8B7G497_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Microcebus murinus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2022Legal notice