Dataset for protein classical BH3-containing proteins of organism Meleagris gallopavo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               *:..  . *:                                                       
mdrpsyleedyssldGldddvfhSddfgla--------------------------------------------------
--------------- mkspevc e--ctlgqpgemtatgiftqnqsyscllgrfqlfplthccgpgvrhpeqqdkatqt

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .*:* **:            *. . * * .  .  .:.   * ..*:.**.:*. *.*:*:    : 
-------------gNaGyRLh------------VppvgFaLdpnlqeepqegqrEartEvqIArkLqcIaDqFh-rlhiq
lspssskprrlfya t t  qhahrtasldfvp snal l caasrwrshslae iqp iw  qe rr g e nasyslp

       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
*     : . . *: :* :  : .*                       ..*.     
RhqqnrnqvwwqLflfLhnlalnvE-----------------------anRnrtgqr
 lgacpdaaphp lpl shqlilf ficfspalesaaslvdllvfppccs g-----
© 1998-2022Legal notice