Dataset for protein classical BH3-containing proteins of organism Meleagris gallopavo

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A803YBD7_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A803YBD7_BMF-02       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
G1MV54_BCL2L11-01       ---------------GMKSPEVCSE--CTL--------------------
                                                                          

A0A803YIP1_PMAIP1-      -----------------------------------------LSGKDLVRI
A0A803YBD7_BMF-01       LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSKPRRLFYGNAGYRL
A0A803YBD7_BMF-02       -------------------------------------------GNAGYRL
G1MV54_BCL2L11-01       -------------------------------------------ANTGTRL
                                                                   .:   *:

A0A803YIP1_PMAIP1-      K------------------------SPSPCACSAERDAVAECALELRKIG
A0A803YBD7_BMF-01       H------------VPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A803YBD7_BMF-02       H------------VPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
G1MV54_BCL2L11-01       QHAHRTASLDFVPVSNALFLLCAASRWRSHSLAEEIQPEIWIAQELRRIG
                        :                           .     *  .    * :*. *.

A0A803YIP1_PMAIP1-      DKAD----------------------LQQKVLNLIAKLF-----------
A0A803YBD7_BMF-01       DQFH-RLHIQRHQQNRNQVWWQLFLFLHNLALNVE---------------
A0A803YBD7_BMF-02       DQFH-RLHIQRHQQNRNQVWWQLFLFLHNLALNVE---------------
G1MV54_BCL2L11-01       DEFNASYSLPRLGACPDAAPHPLLPLLSHQLILFEFICFSPALESAASLV
                        *:                        * :  : .                

A0A803YIP1_PMAIP1-      --------CPKKPRPRC
A0A803YBD7_BMF-01       --------ANRNRTGQR
A0A803YBD7_BMF-02       --------ANRNRTGQR
G1MV54_BCL2L11-01       DLLVFPPCCSRG-----
                                . .      

© 1998-2022Legal notice