Dataset for protein classical BH3-containing proteins of organism Meleagris gallopavo

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A803YBD7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Meleagris gallopavo GN=BMF (length=181 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSKPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQL
FLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A0A803YBD7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Meleagris gallopavo GN=BMF (length=118 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A0A803YIP1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Meleagris gallopavo GN=PMAIP1 (length=61 residues).
LSGKDLVRIKSPSPCACSAERDAVAECALELRKIGDKADLQQKVLNLIAKLFCPKKPRPRC
>gnl|bcl2dbpro|G1MV54_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2L11 (length=132 residues).
GMKSPEVCSECTLANTGTRLQHAHRTASLDFVPVSNALFLLCAASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYSLP
RLGACPDAAPHPLLPLLSHQLILFEFICFSPALESAASLVDLLVFPPCCSRG
© 1998-2022Legal notice