Dataset for protein Bmf of organism Meleagris gallopavo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************                                                  
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------------------------------------
                              gqpgemtatgiftqnqsyscllgrfqlfplthccgpgvrhpeqqdkatqt

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *******************************************************************
-------------GNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQL
lspssskprrlfy                                                                   

       170       180 
....:....|....:....|.
*********************
FLFLHNLALNVEANRNRTGQR
                     
© 1998-2021Legal notice