Dataset for protein Bmf of organism Meleagris gallopavo

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A803YBD7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Meleagris gallopavo GN=BMF (length=181 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSKPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQL
FLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A0A803YBD7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Meleagris gallopavo GN=BMF (length=118 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
© 1998-2022Legal notice