Dataset for protein Bmf of organism Meleagris gallopavo

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1NHG8_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
G1NHG8_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA------------------------------
                   ******************************                              

G1NHG8_BMF-01      THCCGPGVRHPEQQDKATQTLSPSSSKPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEG
G1NHG8_BMF-02      ---------------------------------GNAGYRLHVPPVGFALDPNLQEEPQEG
                                                    ***************************

G1NHG8_BMF-01      QREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQ
G1NHG8_BMF-02      QREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQ
                   ************************************************************

G1NHG8_BMF-01      R
G1NHG8_BMF-02      R
                   *

© 1998-2021Legal notice