Dataset for protein classical BH3-containing proteins of organism Marmota marmota marmota

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
vfqimemq--qvsseldre-g-lqpglrer--qlm  ak--knl---eqqgcplsrlqrfpltspqgpglpptsqhpfat
m p pakeapdcvlrcqedvsspelafgpsqlgtq  s-vwaheynq---tpgegegdlc hghcc  larrdtpg    
    e fl ne ae  edisfemdgc  gleaaql  plmh dafkps psne a                 a ge    
                ac  d a d        d   mal     anq ldaa                           
                                       g      l                                 

        90       100       110       120       130       140       150       160
                          qqrtqps snsps gvml agv  epq             pshflaslpssesq
                           kaq  l pahgg                           ha    gtd gyep
                                                                        d   d  m

       170       180       190       200       210       220       230       240
                           *  : ::.                                             
qe--adm-grsrsappnlwp--eygrq qsfsekvwl--prlpst--ffnny-p-dhpqmvilkvwncrslylsl-hlng
pavtwvl            aavsstsk acmr qmh-wrkta rp spptrscrrrs vlll ss wsflqsfr-vt g 
ergqsqh            - trlmig   la nlegsq g     lhmqqh qnqn      g  tr fkpwhnrn   
a   gpf              qqg             rk        agaaa m ll         lq a f  dqa   
                     l               hf                                    l    

  n dr gpq
© 1998-2023Legal notice