Dataset for protein classical BH3-containing proteins of organism Marmota marmota marmota

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5YUG6_PMAIP1-      ----------------------------------MPGKKGWKNE-QLTPV
A0A8C6A7B1_PMAIP1-      ----------------------------------MPGKKVSKHALNPTQV
A0A8C5YPB3_BIK-01       ------MLANQVALRLACIGDEMDLCFRGLQLAQLPGMAMH---------
A0A8C5YNZ8_BCL2L11      ----MAKQPSDVSSECDREGGQLQPA--ERPPQLRPGAPTS---LQTEPQ
A0A8C5YNZ8_BCL2L11      ----MAKQPSDVSSECDREGGQLQPA--ERPPQLRPGAPTS---LQTEPQ
A0A8C5Z4I8_BAD-01       MFQIPEFEPSE-----QEDSSSAEGGLGPSPAGDRPGP------YKNQPP
A0A8C6A5T3_BMF-01       VFP-EEMEPPQCVEELEDDVFQPEDG----EPGTQPGSLLSADLFAQSQL
                                                           **             

A0A8C5YUG6_PMAIP1-      TPA-----------------------------------------------
A0A8C6A7B1_PMAIP1-      SAE-----------------------------------------------
A0A8C5YPB3_BIK-01       --------------------------------------------------
A0A8C5YNZ8_BCL2L11      GNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A8C5YNZ8_BCL2L11      --------------------------------------------------
A0A8C5Z4I8_BAD-01       GCGLA------------PGLPRDTGH------------------------
A0A8C6A5T3_BMF-01       DCPLSRLQLFPLTHCCGPGLRPTSQE------------------------
                                                                          

A0A8C5YUG6_PMAIP1-      --------------------------------------------------
A0A8C6A7B1_PMAIP1-      --------------------------------------------------
A0A8C5YPB3_BIK-01       --------------------------------------------------
A0A8C5YNZ8_BCL2L11      YFSFDTDRSPAPMSCDKSTQTPSPPCQA------------------FNHY
A0A8C5YNZ8_BCL2L11      ------DRSPAPMSCDKSTQTPSPPCQA------------------FNHY
A0A8C5Z4I8_BAD-01       ------QQRQATSSSNHGG------AGATETRSR------------HSSY
A0A8C6A5T3_BMF-01       ------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASF
                                                                          

A0A8C5YUG6_PMAIP1-      -----------------------------VELESGIQLRRFGDKVNFRQ-
A0A8C6A7B1_PMAIP1-      -----------------------------VETEGMSQLRRFGDKLNFHK-
A0A8C5YPB3_BIK-01       --SLALSYSQARVTGVLR--------------SLTQGLASLRENMWFWRP
A0A8C5YNZ8_BCL2L11      LSAMASMRQSQAEPADMR-----------PEIWIAQELRRIGDEFNLYYP
A0A8C5YNZ8_BCL2L11      LSAMASMRQSQAEPADMR-----------PEIWIAQELRRIGDEFNLYYP
A0A8C5Z4I8_BAD-01       PADTDLDEEMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFK
A0A8C6A5T3_BMF-01       PAGLPLGEQPPEGQWQHR-----------AEVQIARKLQCIADQFH----
                                                             *  : ::.     

A0A8C5YUG6_PMAIP1-      -----------------------KLLNLISKLFSLVT-------------
A0A8C6A7B1_PMAIP1-      -----------------------KLLNLIFRPFS----------------
A0A8C5YPB3_BIK-01       TAPSTRVPPARACRELLPVLLLLGLLLSRALYLRLQ--------------
A0A8C5YNZ8_BCL2L11      R----RVFFNNYQPEDHPQMVILRLLRCIIRLVWRMH-------------
A0A8C5YNZ8_BCL2L11      R----RVFFNNYQPEDHPQMVILRLLRCIIRLVWRMH-------------
A0A8C5Z4I8_BAD-01       GLPRPRSAGTASQMRQS------SSWTRFIQSWWDRNLG---RRGSAPSQ
A0A8C6A5T3_BMF-01       -----RLHMQQHQQNRN------RVWWQILLFLHNLALNGDENRDRAGPR
                                                                          

© 1998-2022Legal notice