Dataset for protein classical BH3-containing proteins of organism Marmota marmota marmota

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A8C5YNZ8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNLY
YPRRVFFNNYQPEDHPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A8C5YNZ8_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PADMRPEIWIAQELRRIGDEFNLYYPRRVFFNNYQPEDHPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A8C5YPB3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Marmota marmota marmota GN=BIK (length=105 residues).
MLANQVALRLACIGDEMDLCFRGLQLAQLPGMAMHSLALSYSQARVTGVLRSLTQGLASLRENMWFWRPTAPSTRVPPAR
ACRELLPVLLLLGLLLSRALYLRLQ
>gnl|bcl2dbpro|A0A8C5YUG6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Marmota marmota marmota GN=PMAIP1 (length=52 residues).
MPGKKGWKNEQLTPVTPAVELESGIQLRRFGDKVNFRQKLLNLISKLFSLVT
>gnl|bcl2dbpro|A0A8C5Z4I8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Marmota marmota marmota GN=BAD (length=170 residues).
MFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPGPYKNQPPGCGLAPGLPRDTGHQQRQATSSSNHGGAGATETRSRHSSYP
ADTDLDEEMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPRSAGTASQMRQSSSWTRFIQSWWDRN
LGRRGSAPSQ
>gnl|bcl2dbpro|A0A8C6A5T3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Marmota marmota marmota GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
>gnl|bcl2dbpro|A0A8C6A7B1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Marmota marmota marmota GN=PMAIP1 (length=50 residues).
MPGKKVSKHALNPTQVSAEVETEGMSQLRRFGDKLNFHKKLLNLIFRPFS
© 1998-2022Legal notice