Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------makqpsdvssecdregrqlqpaerppqlrpgapt
mepsrcvemfqipefepseqedsssaerglgpltmevlgvtdpeed--slag-rpld-gkhhlkapgllwdashqqeqts
        eleddviqredgmpgaqpgss sa              ld----q---- -msrkm rkntqcsgtglrpsl
         sgvrp s dtl etlly ql e                 dmfafsl   plpsd  flrah cppeaqvgq
                                                p ed d    med    a   a i d md e 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
slqtepq-----------------------ap-asp-pfatrspl---------------g-f----drspapmscdkst
qsshhtggnpegnhggegdscphgspqgpl--p---g--------fifmrrssllsrsss-y-sfdt--r-rlra--p--
redkagarrwyspswesqlhftrstlgvaspsqgvslicgvteeplaenvklka glwrqrlsyapapy-l----sp-vl
evtrla ldrf fki me  enp asmpsts lrlmygatssvdv              p vetgnsapkgvvyttlenw
agpcg   aqa dg          lrllemr rhmar ysqqdqr                maee  gf sqsv fqdlv
 aea                    kke  eh a   f teep aq                h d   e  rprp df if
                         ga         a hdde  i                         d cd a  g 
                                            e                                 a 
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qt--psppcqafnhylsama-rr-aepad--p-i----------------------------------------------
--ig-----gewrr-p--f-s--q---r-mr-g-riaqelrriggrwfgdefnayyarrvslpsyqgaedhpqmvilrll
wq  tqlyq--l--s-vt-vawlldas-pstlelltvllqssgytvvwqshlqvnwqlgsfennrvatltripfrcm   
vp  sernirt-wsrsqplivsnewvgttqssrthvqmvallswrlklllwwhrtnpanlvaslssspgpq         
tg  lrqggmrsqqmanvrlrkkstsvvspvrpqastgrgqyrnlhh kirsflsll lnlkqpqn g            
ra  eae elq epl lnqgniikrlikgklhlfqlr hdhnci    hhlredqek emkdledg              
l   a   akn   k ee  lgffqiadeeif aikl f         eekpdchcg  hg f a               
         fk   d d   ifeagc   cfa   f  a          cf        ce e                 
         eg     a   ded e          a                        a                   
                      a c                                                       

       250 
....:....|.
           
-----------
ryivrlvwrmh
           
           
           
           
           
           
           
           
© 1998-2021Legal notice