Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------qps----e-mre---fqpsegepslqpgsglspqlfpqr-sd---------c-----q--------spqq
mpgkkarmnm---rvvs-lefqirv---edrpdqssaerstglsteg--p--gnhggegds-plsrr-lppllwdcghll
       kake  ptseqcdddgpqlera-q--gar--ap--ad-aadsllp          gkhhl afg thca--ga
         a   dcra agsgv eisg-t-te---y --ie-- --tgrpk           hgsp     vvsvtd-v
                    qa  p   talmatdl  ql  ml mf dnke                     lps cpk
                    l       d    r    f      he  g                       agm  de
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
epttqsskatqtl-pespsqgvmrpagvteepqr-f----l------adppl-l--------------------------
rqpspephhgg--g---rl---llrsslssd-s-l-ygpd-yrssvv-----v-atrysqpcqlrrhyvsfvdsfttlrp
stagsmerfq-lssyat--vvsvalcrtqyttgviyratatpglpsssstvtltsrlpqptekqwqvsrtamagrrqaee
pdrdhldqvdrknnvrqsmrslsyklkillss-sswtssrgrqrtrpqpssqwnqqiggr dgifprple l   kg   
lcq  grpc pfghmlekgmniiedifdggrmdmglfqnpfdkhrlemmhqksgpkgfdg  fe nmld  a        
  l    f  daecf dadllfada ccedlf leeepleeaaehh   fnagalidea   ea dl             
       d  a  a     hid      c  e f    f      e   ce   hf      d                 
                   fha         a e           a    d    e                        

       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
                                                                    
--------------------------------------------------------------------
nimrpevsprpkswcirtqfvrlyvrrrvlqsfwqallsrgsvlplslrylvrlvwrmeqnrngpgpr
ad  fwrriareltvtadvvrqyssytvlfnnyqlrsqnpwrswlsqvlgitqiplngmee g a   
    a iqltqstrrslglqngsllwqci lkwpehqhknqmhiwrl gf hn af ch         
       n narkqpageemlahhgqg f kclld ndhgnl a qk                     
             pg    lk  fa     ha ea ecg       i                     
             a      h                 c                             
                                                                    
© 1998-2020Legal notice