Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------makqpsdvssecdregrqlqpaerppqlrpgaptslqtepqgnpegnhgge------sc--gsp
mfqipefepseqedss--erglgp-lag-mp--cgkhhrqasgtlwdsslqqeqptss---------glfpld--ph---
 sgvrpisrdtlmetlsy------v---eddsdvfrkndge-paqaqvthpadlfap-shhcplsrmqtssrthscgpgl
                l mel rcleml -- kka--ea-- --vl  gqevtdldarllfdgglwleqrlmlllyrakt
                      e  t e     --  --         edag cg  mrrd ftinyrdkd naitplfs
                                                   e aa  leqa dkecv     h frl ck
                                                          dd   aaaf        ak  i
                                                                               c
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qgplappaspgpfatrspl---m--s-l-----------r--s--f----drspapmscdkstqt-psppcqafnhylsa
-------------------fif-rr-s-sygqtdenvls-ss-gy-sfdt-tl------------rr---p--w------
sptsqeskatstlgqavasapvslpcgvrqdrla   tlepqrlfyapgfa--rvvavrptilryg-qss-ft-vsrwqv
reergvderdqarrplervqgpnvgaaqiea      kekrlpvtwvdavykp tlygtvrvwgwwtkqnwtssrrsset
pwsmsmllnarrkmlqdq lrmlawltfg        ei dvlrs rnsptga rctdprntmpq qelferrvqqeqwr
lvdeehedl pghlg  e  mh    ed         d  amgde l rgp   l r lqlhk m eacaagqafkdprp
gd  dd  e a  ee                               g  ek     k fgga  i      eg e ae d
e                                                 e       aee   f       e c  a  
                                                            a             a     

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
                                                                         
masrr-aepad--------------------------------------------------------------
-----q-----mrpgiriaqelrriilhkfgdefnayyarrlflnnyqaaedhpqmvilrllryivrlvwrmh
lvlgllsvlpsssgelhltlfrlyg     qnrsrvwwqlnvsksslsstgeenrngagpr            
rlvwqgdsavlqvrrftvrplqcmc     hhhrqdtepilmleppdaln                       
qgrinetlvttlll  qqqgkd        ee nhcq   ehkdlla                          
ptpfkhqiskgcih  ikl h            le n    ceah                            
gnneialcmda ff  afi                       a f                            
 ii e eai                                                                
  a d   g                                                                
© 1998-2023Legal notice